KEGG   Salinispora arenicola: Sare_2024Help
Entry
Sare_2024         CDS       T00613                                 

Definition
(GenBank) cytochrome P450
  KO
K21329  aminosugar N-oxygenase [EC:1.14.15.-]
Organism
saq  Salinispora arenicola
Pathway
saq00523  Polyketide sugar unit biosynthesis
saq01110  Biosynthesis of secondary metabolites
saq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sare_2024
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.-  
     Sare_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: ABV97894
UniProt: A8LZN1
Position
complement(2314564..2315838)
Genome map
AA seq 424 aa AA seqDB search
MTGYQDRPTGDQPGAPVPSGSTDPGIGAFPLPRRCPFSPPAEYARLRAEHPVVRLPMLGG
DTAWVVSRHADVRQVLSDPRMSADRRRPGFPKFAPTTEGQRQASFANFRPPLNWLDPPEH
AICRRQIVDEFSVRRVRQSRALVERVVDTHLDALTAAAPGADLVSTFAYPVPSQVICEVL
GVPYGEHEFFERRSTLMFRRSTPADERARCAREIRDFLDVVVTDKERRPGDDVLSRLLYR
QRRAGGVDHEAVVSMAFVLLVAGHVTTSNMLALSVLALLTHPARLARLRAEPERFPAAVE
ELLRYFTVVEAATARTTTAEVTIGGVTIAAGEGVVALGQAANRDPRVFEHPDEFDPDRDA
RAHLAFGHGRHICPGQHLARLEMEVALSRLFRRLPGLRLTMEVSDLPLKEDSNIFGLYAL
PVAW
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggtaccaggaccggccgaccggcgaccagcccggcgctccggtgccgtcaggg
tcgaccgatccgggcatcggcgcgtttccgctgccccggcgctgccccttcagcccacct
gccgagtacgcccgactacgcgccgagcatccggtcgtccgactgccgatgctcggcggt
gacacggcctgggtggtctcccggcatgccgacgtccggcaagtgctcagcgatccccgg
atgagcgcggaccgacgtcgacccggtttcccgaagttcgcgccgacgacggagggccag
cggcaggcgtcgttcgcgaacttccgcccaccgttgaactggctggacccgccggagcac
gccatctgtcggcgacagatcgtcgacgagttctccgtgcgccgggtccggcagtcacgg
gcgttggtcgaacgggtcgtcgacacgcacctcgacgcgttgaccgccgccgcgcccggc
gccgacctggtgtcgacgttcgcctacccggtcccatcacaggtgatctgtgaggtactc
ggcgtgccctacggcgagcacgagttcttcgagcgccgttcgacgctgatgttccgccgg
agcacgccggccgacgaacgcgcccgctgcgcccgggagatccgcgattttctcgacgtg
gtggtcaccgacaaggagcgccgtcccggcgacgacgtgctcagccggctgctgtaccgg
cagcgccgcgccggtggcgtggaccacgaggccgtggtgagcatggccttcgtgctgctg
gtcgccgggcatgtcaccacgtccaatatgctcgcgttgagcgtgctggccctgctcact
catccggcacggctggcccggctacgcgccgaaccggaacggttcccggccgccgtggag
gaactgctgcggtacttcaccgtggtcgaggcggcgacagcccgcaccaccaccgccgag
gtcacgatcggcggggtgaccatcgcggcgggagagggggtggtggcgctggggcaggcg
gcgaaccgtgatccgagggtgttcgaacaccccgacgagttcgaccccgaccgggacgcc
cgtgcgcacctcgccttcggccacggccggcacatctgcccgggtcagcatctcgctcgg
ttggagatggaggtcgcgctcagtcgcctgttccggcggctgcccggcctaagactcacg
atggaggtttccgacctgcccctcaaggaggacagcaacatcttcgggttgtacgcccta
ccggtcgcctggtga

DBGET integrated database retrieval system