KEGG   Salinispora arenicola: Sare_2170
Entry
Sare_2170         CDS       T00613                                 

Definition
(GenBank) O-methyltransferase family 2
  KO
K21258  orsellinic acid C3-O-methyltransferase [EC:2.1.1.-]
Organism
saq  Salinispora arenicola
Pathway
saq01059  Biosynthesis of enediyne antibiotics
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
Module
saq_M00833  Calicheamicin biosynthesis, calicheamicinone => calicheamicin
saq_M00834  Calicheamicin orsellinate moiety biosynthesis, malonyl-CoA => orsellinate-ACP => 5-iodo-2,3-dimethoxyorsellinate-ACP
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    Sare_2170
Enzymes [BR:saq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Sare_2170
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation2 MarR_2 Rrf2 HTH_20 HTH_45 HTH_15 Dimerisation HemN_C
Other DBs
NCBI-ProteinID: ABV98033
UniProt: A8M0M3
Position
2494192..2495190
AA seq 332 aa
MDRLQSALALYAEAMGYTYAAALRAAATIGVADHLRGRPRTAAELATATGTDPDALRRVL
RLLAARDIVRESDGRFALTDKGAALRSDAPVSARAGILMFTDTMFWTMSHRIARTVRFDR
PTFADIFGGTLDDYFEGAADVEALYYEGMETVSAAEHLILARRGVFPTTGTVVDVGGGRG
GFLLTVLREHPGLRGVLLDRVEVVGRHRLDEPDVAGRWKAVPGNFLCEVPPADVHVLKRI
LHNWDDERSLRILANCRRAMPSHGRVLVIDAIVPEGNTPHQSKQMDFMMLAARTGQERTV
AELAPLFGAAGLRLDQVVGTASVMSIAVGVPA
NT seq 999 nt   +upstreamnt  +downstreamnt
atggacaggttgcagtcggcgctggccctctatgccgaggcgatgggatacacctacgcg
gcggcgctgcgtgcggcggccaccattggagtcgccgaccacctgcggggcaggccgcgg
accgcggccgaactggccaccgccaccggcaccgatcccgatgcgctgcgccgggtgctg
cgcctgctcgcggcccgcgacatcgtccgcgaatccgacggccggttcgctctcacggac
aagggagccgcgctgcgctcggatgccccggtgtcggcacgcgccggcatcctcatgttc
accgacaccatgttctggacgatgagccaccggatcgcccgcacggtacggttcgaccgg
ccgacgttcgccgacatcttcggtggcaccctggacgactacttcgagggcgccgccgac
gtcgaggccctctactacgagggcatggagacggtcagtgcggcggaacacctgatcctc
gcccgccgcggcgtcttccccacgaccggaacggtcgtggacgtcggcggtgggcggggc
ggcttcctcctcaccgtcctgcgtgaacatcccggcttgcggggagtgctactggaccgg
gtggaggtggtcggccggcaccggctggacgagccggacgtggccggccgctggaaggcc
gtcccggggaacttcctctgtgaggtgccccccgccgacgtgcacgtactcaaacggatc
ctgcacaactgggacgacgagcggagcctgcggatcctggccaactgccgccgagccatg
ccgagccacggccgggtcctggtgatcgacgcgatcgtgccggagggtaacaccccacac
cagagtaagcagatggacttcatgatgctggccgcgcgcaccggccaggagcgcaccgtg
gccgaactggcaccgttgttcggtgcggccgggctgcgcctggatcaggtggtcggtacc
gcgtcggtgatgtccatcgcggtcggtgtaccggcctga

DBGET integrated database retrieval system