KEGG   Salinispora arenicola: Sare_2325Help
Entry
Sare_2325         CDS       T00613                                 

Definition
(GenBank) methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
saq  Salinispora arenicola
Pathway
saq00270  Cysteine and methionine metabolism
saq00450  Selenocompound metabolism
saq00670  One carbon pool by folate
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sare_2325
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Sare_2325
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Sare_2325
Enzymes [BR:saq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Sare_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans Pterin_bind Met_synt_B12 B12-binding_2 B12-binding CM_2
Motif
Other DBs
NCBI-ProteinID: ABV98183
UniProt: A8M267
Position
2667778..2671293
Genome map
AA seq 1171 aa AA seqDB search
MVISVLDALTDRILVADGAMGTMLHAADLTLDDFDGLEGCNEILNVTRPDAVRSVHEAYL
AVGADCVETNTFGANLPNLAEYGIEGRIRELSEAGARLARTAADAYATPEQPRFVLGSIG
PGTKLPTLGHASYASLRDAYRENAAGLIAGGSDALIIETCQDLLQVKAAVIGSKRAMAEL
GRTVPIICHVAVETTGTMLLGSEIGAALAAIEPLGIDLIGLNCSTGPAEMGEHLRYLSQH
SRIPVSVMPNAGLPVLTSDGAYFPLTPDEMADALERFVTDYGVALVGGCCGSTPEHIRVL
AERLRGRSPVAREPRPEPGASSIYHQVPFAQDASVLMVGERTNANGSKAFREAMLAGDWQ
ACVEIARGQARDGSHLLDLCVDYVGRDGTQDMRELAGRFATASTLPIMLDSTEPGVIEAG
LETLGGRCVVNSVNFEDGDGPDSRYARLMPVVKEHGAAVVALLIDEEGQARTKDWKVRVA
TRLIDDLTGRWGMARSDILIDALTFPIATGQEETRRDGIETIEAIREIAARYPGVNFTLG
ISNVSFGLNPAARQVLNSVFLHECVQAGLTSAIVHASKILPIAKIPSEQREIALDLVYDR
RREGYDPVQRFIETFEGVDAASARASRAEELAALPLNERLKRRIIDGERNGLEADLDAAL
AAGMTALVVINDILLDGMKVVGELFGAGQMQLPFVLQSAEVMKSAVAYLEPHLEKADDGG
KGRIVLATVKGDVHDIGKNLVDIILSNNGYEVVNIGIKQPINAILDAAEQHRADAIGMSG
LLVKSTVIMKENLVEMATRGVAERWPVLLGGAALTRAYVEDDLRSMFPGQVHYARDAFEG
LSLMDRVMAAKRGGAPVVDAEREAALAARRARRERQRAVVSESLPELHDASVRSDVATDV
DLPTPPFFGTRVIKGLPLADYAALLDERATFLGQWGLRGARGGKGPSYEELVETEGRPRL
RYWLDRLAADQVLEAAVVYGYFPAYSDGNDLVVLDENGHAERARFTFPRQRQERRLCLAD
FFRPRGAELDVVALQLVTVGQPISEYTAKLFARNEYRDYLEVHGLSVQLTEALAEYWHRR
IRTELTLPGDRTVAVDDPADLAGLLRNDYRGCRYAFGYPACPDLTDRAKLVELLGAERIG
VHLSEEFQLVPEQATDAIVVHHPEASYFNAK
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatctctgtgctcgacgcgctgaccgaccggatcctcgtcgccgacggggcgatg
ggcacgatgttgcatgcggcagacctgaccctcgacgacttcgacggactggagggctgc
aacgaaatcctcaacgtgactcggccggacgctgttcgcagcgtgcatgaggcatacctg
gccgtgggcgcagactgtgtggaaacaaacacatttggtgctaacctccctaacctcgcc
gaatacggcatcgaggggcgtatccgggagctgtccgaggcgggcgcccggctggcccgc
accgccgccgacgcgtatgcgacgccggagcagcctcgcttcgtcctcggctcgatcggg
ccgggcacgaagctgcccaccctcggacacgcctcgtacgcctcgctgcgggacgcgtac
cgggagaacgccgctggcctgatcgccggtggatcggacgcgctgatcatcgagacctgc
caggacctgctccaggtgaaggcagcggtgatcggctcgaagcgagcgatggccgagctg
ggccgaacggtcccgatcatctgccacgtggcggtggagaccaccggcacgatgctgctg
ggcagcgagatcggcgccgcactggccgcgatcgagccgctcggcatcgacctgatcggg
ctgaactgctccaccggcccggccgagatgggcgagcacctgcgctatctttcgcagcac
tcgcggattccggtgtcggtgatgccgaacgcgggcctgccggtactcacctccgacggt
gcgtacttcccactgacgccggacgagatggccgacgccctggagcggttcgtcaccgac
tatggcgtggcactggtcggcggctgttgcgggagcacgccggagcacatccgggtgctg
gcagagcggctgcgtggccggtcgccggtggcgcgggagccgcggccggagccgggcgcc
tcgtcgatctaccatcaggtgcccttcgcgcaggacgcgagcgtgttgatggtgggggag
cggaccaacgccaacggatccaaggcgttccgtgaggccatgctcgccggggactggcag
gcgtgtgtcgagatcgcccgcggtcaggcacgggacggttcgcatctgttggacctgtgt
gtggactacgtgggccgggatggcacccaggacatgcgcgagctggctggccggttcgct
accgcctccacgttgccgatcatgttggactcgaccgagccgggtgtgatcgaggccggg
ctggagacccttggcggtcggtgtgtggtcaactcggtcaacttcgaggacggcgacggc
ccagactctcggtacgcccgcctgatgcccgtggtgaaggaacacggtgcggcggtggtg
gcgcttctcatcgacgaggaggggcaggcgcgtaccaaggactggaaggtgcgcgtggcc
acgcgattgatcgatgacctgaccggccggtgggggatggcccggtcggacatcctcatc
gacgccctgacctttccgatcgccaccgggcaggaggaaactcggcgggacgggatcgag
accatcgaagcgattcgggagatagccgcccgctacccaggagtcaacttcaccctgggt
atctccaacgtctcgttcggcctcaacccggcggcccggcaggtactcaactcggtgttc
ctgcacgagtgcgtccaggccgggctgacctcggcgatcgtgcacgccagtaagatcctg
ccgatcgcgaagatcccctcggagcaacgggagatcgcgctcgacctggtctacgaccgt
cgccgcgaagggtacgacccggtgcagcgcttcatcgagactttcgagggtgtggacgcc
gcctcggcgcgggccagccgggcggaggaactcgccgccctgccgctgaacgagcggctc
aagcggcggatcatcgacggtgagcgtaacggtctcgaggcggatctggatgcggccctg
gccgccgggatgacggcgctggtcgtcatcaacgacattctgttggacgggatgaaggtg
gtcggtgagctgttcggcgccggtcagatgcagctgccgttcgtgcttcagtccgctgag
gtgatgaagtccgcggtggcatatctggagccgcacctggagaaggccgacgacggcggc
aagggccggatcgtgctcgccaccgtgaagggcgatgtgcacgacatcggcaagaacctg
gtcgacatcatcctgtcgaacaacggctacgaggtggtgaacatcggcatcaagcagccg
atcaacgcgatcctcgacgccgccgagcagcaccgcgcggacgcgatcggcatgtccgga
ctcctggtgaagagtacggtcatcatgaaggagaacctggtcgagatggccacgcgtggt
gtcgcggagcgctggccggtgctgctcgggggtgcggcactgactcgcgcgtatgtcgag
gacgacctgcggtcgatgttccctggccaggtgcactacgcacgggatgcgtttgagggg
ctgtccctgatggatcgggtgatggccgccaaacgcggtggcgcaccggtggtggatgcg
gaacgggaggcggccctggccgcccggcgggcccgccgggagcggcagcgggcggtcgtc
agtgagtcgttgccggagctgcacgacgcatcggtccgctccgacgtggccaccgatgtg
gacctacccaccccgccgttcttcggcacccgggtcatcaaggggctgccgctcgccgac
tacgcggcgttgctcgacgagcgggcgacgttcctcgggcagtggggactgcgcggtgcc
cggggcggtaagggcccgtcgtatgaggaactggtggagaccgagggccggccgcggctg
cgctactggctggaccggctcgccgctgaccaggtactcgaggcagctgtcgtgtacggc
tacttcccggcctactcggacggcaacgacctggtcgtgctcgacgagaacggccatgcc
gagcgggcccgcttcaccttcccgcggcagcgccaggagcggcggctctgcttggctgac
tttttccgcccccgtggtgccgaactggatgtggtggcactgcaactggtcaccgtcggc
caaccgatcagcgaatacacggcgaagttgttcgcccgcaacgagtaccgagactatctg
gaggtccacgggctgtcggttcagctcaccgaggcccttgccgagtactggcaccggcgg
atccgcaccgagctgacgctgcctggcgatcgtacggtggccgtggacgatccggccgat
ctggctgggctactgcgcaacgactaccggggctgccggtatgcgttcggctacccggcc
tgtcccgacctgacggaccgggcgaagctcgtggaactgctgggggcggaacggatcggc
gtgcacctgtcggaggagtttcagctcgtcccggagcaggcaaccgacgcgattgtcgtg
caccatccggaggcgagttacttcaatgccaagtga

DBGET integrated database retrieval system