KEGG   Salinispora arenicola: Sare_2330Help
Entry
Sare_2330         CDS       T00613                                 

Definition
(GenBank) VioB - polyketide synthase
  KO
K20076  chromopyrrolic acid synthase
Organism
saq  Salinispora arenicola
Pathway
saq00404  Staurosporine biosynthesis
saq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Sare_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferritin-like
Motif
Other DBs
NCBI-ProteinID: ABV98188
UniProt: A8M272
Position
2680051..2683260
Genome map
AA seq 1069 aa AA seqDB search
MSVFDLPRLHFRGSATTHLPTGPRNGLVDLATNTALTEDGRAFPVASPAHAYHDYLDQVG
PRFDLAGRPCADGPFSVAKGRDFAGNGHFSVDARIVSVEVRTSEINTVDPVVGRTVDMWG
HYNEYLGTTVNRARVFDVDPASNRTTTLMVGQFGFGRDGRSHDVGYLATGRVHGFVPPRW
HNADHAVDIDDHWQANDLRRSVVHQFVVTADELTWLDEPAASPAVRLLRDTDASGLVVQF
SLSRMSVPSAPDQPSRWQLNGTIAPWYPHEPRTYPAGRLLVPDSRGPSRTDGRLHNLSVE
LTDTHAILNMITAVPTVGTGPVDVGDLELRTAGDGRLVARLPREAYLGQEYLLACGLVTV
PIEMSAEAASEEPLSLVSRRPGGPVRQLREREVNVQVDESALILEHPRDAEDAHHDVEVP
VRAFVRGRPGAVHEIAVRQFFNPRALPGEAAARSPKARCSDIDVLRLRPGRLDEAGGWSS
ACVLGTDQAGCGWFTMRGATAGTALVLLSTDADDLPCDPEAPGSATLAYDHDDVLGYWPG
AGYLSIRVLPDDWRLAGLEQKDVTFELVYREVFAFYEHLFSFMKAEVFSLADRCKVETYA
KLIWQMCDPRNKAKTYYMPPTRDLSEPKARLLLKYLRAQQVPDAVLLTAPATNRRSRRIA
TRDQLVRVLREAAKVELAVMLQYLYAAYSVPAYGVGLEYVRQGGWTREQLRLACGDGGET
LDEGVRSMLLNIAREEMIHFLLVNNILVAMGEPFHVPWIDFATINHELPVPLDFCLEGMG
IGSVERFTMIERPESHVPDVLGTGGATAQDDGHTYASLSDLYSAIREGLQHIPGLFLVDK
GRGGGEHHLFLRESINSRHPDYQLEVDDLSSALFAIDVITEQGEGGVLTAGPDEVSHYTS
FLRIGELLRGAVAPGGDPWHPAYPVLRNPTLRHGERAMETVTDPDARTVMALFNRAYFMA
LQLMAQHFGERPDGSLRRSDLMNGAIDMMTGLMRPLAELLVTMPSGRRGRTAGPSFELVE
QPTPVSRPEVARRGIALRLDDLAAECGKSALVPTRVGEMSAFWADHFRP
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcttcgacctaccacggctgcacttccgtggatcggcgacgacgcacctgccc
accgggccacgcaacggcctggtggacctggcgacgaacacggcgctcaccgaggacggc
agggcctttcccgtagcgagtccggctcacgcctaccacgactacctcgaccaggtggga
ccacgcttcgacctcgccgggcgtccctgcgccgacggacccttcagcgtggccaagggc
agggacttcgccggcaacggacacttttcggtggacgcgcggatcgtcagcgtcgaggtc
cgcacgagcgagatcaacaccgtggacccggtggtcggacgcaccgttgacatgtggggg
cactacaacgagtacctcggcacgacggtgaaccgggcccgggtcttcgatgtcgacccg
gcctccaaccggaccacgacgctgatggtcgggcagtttggcttcgggcgcgacgggcgg
tcccacgacgtcggctacctcgccaccggccgcgtccacgggttcgtgccgccacggtgg
cacaacgcggaccacgccgtcgacatcgacgaccactggcaggccaacgacctgcgccgg
tccgtcgtgcaccagttcgtggtgacggcggacgaactgacctggctcgacgagccggca
gcctccccggccgtacgtctgctcagggacaccgacgcaagcggcctggtggtgcagttc
tcgctcagccgcatgtccgtcccgtccgcgcccgaccagccgagccggtggcagctcaac
gggacgatcgccccctggtacccgcacgaaccgcgcacctacccggcgggtcgcctactc
gtcccggacagccgaggtccgagccgcaccgacggccggctgcacaacctctcggtcgag
ctgaccgacacccacgccatcctcaatatgatcacggcggtgcccaccgtagggaccggg
ccggtcgatgtcggagatctcgaactgcgtaccgccggcgacggtcgactggtggcccgc
ctgccccgggaggcgtatctcgggcaggagtacctcctggcctgcggcctggtgaccgtt
cccatcgagatgtccgccgaggccgcctccgaggagccgttgagcctggtttcccgtaga
cccggcggaccggtgcgacagctacgggaacgagaggtcaacgtacaggtcgacgaatct
gcgctcatcctcgagcacccacgagacgccgaggacgcgcaccacgacgttgaggttccc
gtgcgggccttcgtccggggccgcccgggtgccgtccacgagatcgcggtacggcagttc
ttcaatccccgggctctgccaggtgaggctgcggcccgttcccccaaggcccgctgctcc
gacatcgacgtgctcaggctgcgtccgggacggctggacgaggccggaggctggtcgagc
gcctgcgttctgggtaccgaccaggcggggtgtggatggttcaccatgcggggtgcgacg
gccggtacggccctggtcctgctgtccaccgacgccgacgacctgccctgcgatccggag
gcacccggatccgccacgctggcctacgaccacgacgacgtgctcggatactggcctggc
gcaggctacctgtcgatccgtgtcctacccgacgactggcggctggccgggctcgagcag
aaggacgtgacgttcgagctggtctaccgggaggtttttgccttctacgagcatctgttc
tccttcatgaaggcagaggtcttcagcctggcggaccggtgcaaggtggagacgtacgca
aagttgatctggcagatgtgcgatccccgcaacaaggccaagacctactacatgccgccg
acgcgagacctgtccgagccgaaggcccggctcctcctaaagtacctacgcgcgcagcag
gtaccggatgcggtcctcctgacggcgccggccacgaatcgccgtagccgcaggatagcc
acacgtgatcaactcgtccgcgtgctgcgtgaggcggcaaaggtcgagttggccgtcatg
ctccagtacctgtacgcagcctattccgtgcccgcctacggtgtcgggctggagtacgtg
cggcagggtgggtggacgcgcgagcagttgcggctggcctgtggtgacggtggtgaaacc
ctcgacgagggtgttcgcagcatgctgctgaacatcgcccgcgaggaaatgatccacttt
cttctggtcaacaacatcctcgtcgcgatgggtgagcccttccacgtgccgtggattgac
ttcgccacgatcaaccacgagctcccagtaccgctggacttctgcctcgaaggcatggga
atcggtagcgtggagcgtttcaccatgatcgaacggcccgaaagccacgtacccgacgtg
ctgggaactggtggcgcgacggcccaggacgacggacacacctacgcctcgctgagcgac
ctgtactccgcaatccgggagggcctgcagcacatccccggcctctttctggtcgacaag
ggtcggggaggcggtgaacaccacctcttcctgcgggagtcaatcaacagtcgccacccc
gactaccagcttgaggtcgacgatctgtcgagcgccctgttcgcgatcgacgtcatcacc
gagcaaggggagggcggagtactcaccgccggacctgacgaggtgtcgcactacacctcg
ttcctgcggatcggcgaactcctccgtggcgcagtggccccgggcggggatccgtggcac
ccggcctatcccgtgctgcgcaacccgacgcttcggcatggcgaacgggccatggagaca
gtcaccgatccagatgcccgaacggtcatggcgctgttcaaccgcgcgtacttcatggca
cttcagctcatggcgcaacacttcggtgaacgccccgacgggagcctgcggcggtccgac
ctgatgaacggggcgatcgacatgatgacgggtctgatgcgcccgcttgctgaactgctg
gtgaccatgccgtcgggacggcgtggcaggaccgctggaccgtcgttcgaactggtggag
cagcccaccccggtgtcccgccccgaggtggcccggcggggcatcgccctgcgtctcgac
gacctcgcggcagagtgcggcaagtccgccctggtgccgacccgggtgggcgagatgagc
gcgttctgggccgaccacttccggccgtga

DBGET integrated database retrieval system