KEGG   Salinispora arenicola: Sare_2331Help
Entry
Sare_2331         CDS       T00613                                 

Definition
(GenBank) cytochrome P450
  KO
K20078  cytochrome P450 StaP [EC:1.13.12.-]
Organism
saq  Salinispora arenicola
Pathway
saq00404  Staurosporine biosynthesis
saq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Sare_2331
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.-  
     Sare_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: ABV98189
UniProt: A8M273
Position
2683326..2684579
Genome map
AA seq 417 aa AA seqDB search
MPSATLPRFALTGWSRENIVNPYPVYQRYREVASVHRGEPGGDAPDTFYVFSYDEVVQVL
SSNCFGRGRSLDAAKASVPVPAEQKALRAIVENWLVFMDPPRHTELRSLLNRSFSPRIVT
ELRPRIARIAQELLSRLGQQVDVDLVESFAAPLPILVISELLGIPEERRAWLRANALALQ
EASSSRAGRDVDGYAQAEVAAQEFTEYFREQVRLRRGRAGGDLITILANAQERGAPVSLD
AIVGTCVHLLTAGHETTTNSLAKAVLALREHPAVLDELRGAEGLTTDAVEEFLRYDPPVQ
AVTRWAHQDTTLGGCDIPRGSRVVALLGSANRDPARFPSPDVLDVRRPADRHLSFGLGIH
YCLGATLARAELEIGLQALLDGVPTLGYGTQHVDYADDLVFHGPSRLVLVNLGERCK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgccatccgcgacgttgccgcggttcgccctgaccggctggagcagggagaacatcgtc
aatccctacccggtgtaccagcgctaccgggaggtcgcttcggtgcaccggggcgaacca
ggcggcgacgccccggacaccttctacgtgttctcctacgacgaggttgtccaggtgctg
tcgagtaactgtttcggtagggggaggtccctcgacgccgcgaaggcatcggtcccggta
ccggccgagcagaaggccctccgggcaatcgtcgagaactggctggtgttcatggacccg
ccacgccacaccgaactacgctcgctactcaaccggagcttttctccccggatcgtgacc
gaactgcggccccgcatcgcgcggatcgcacaggaactcctgtcccggctcggccagcag
gtggacgtcgatctcgtcgagagcttcgccgcgccgttgcccatccttgtcatctccgag
ctgctggggattccggaggagcgtcgcgcatggttgcgtgccaacgcgttggcgctgcag
gaagccagttcctcccgtgcgggtcgggacgtggatggctacgcacaggccgaagtggcc
gcgcaggagttcaccgagtacttccgggagcaggtgcggctacggcggggtcgtgccggt
ggagatctgatcacgatcctcgccaacgcacaggagcgcggtgcaccagtgagtctggac
gcgatcgtggggacctgcgtccacctcctgaccgccgggcacgagaccaccaccaattcg
ctggcgaaggccgtgcttgcgctgcgggaacatccggcggtactcgacgagctccgcggc
gccgaggggctgacgacggatgcggtcgaggagttcctgcgctatgacccgcccgtgcag
gccgtgacccgatgggcgcaccaggacaccaccctcggcgggtgtgacataccacgcggc
agccgagtggtcgcgctgctgggctcggcgaatcgggatccggcacgcttcccgtcacct
gatgtcctggacgtacgtcgccctgccgaccggcacctcagtttcggtctgggtatccac
tactgcctcggcgcgacgctggcccgcgccgagctcgagatcgggctccaggcactgctg
gacggtgttcccacgctgggctacggcacccagcacgtcgactacgccgacgacctggtc
ttccacggaccgagccggctggtactcgtcaacctaggagaaaggtgtaaataa

DBGET integrated database retrieval system