KEGG   Salinispora arenicola: Sare_2332Help
Entry
Sare_2332         CDS       T00613                                 

Definition
(GenBank) Methyltransferase type 11
  KO
K20082  O-methyltransferase StaMB [EC:2.1.1.139]
Organism
saq  Salinispora arenicola
Pathway
saq00404  Staurosporine biosynthesis
saq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Sare_2332
Enzymes [BR:saq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.139  3'-demethylstaurosporine O-methyltransferase
     Sare_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Ubie_methyltran CMAS Methyltransf_12 Methyltransf_29 MTS Methyltransf_8 MetW Methyltransf_32 Methyltransf_9 Methyltransf_20 Methyltransf_15 NNMT_PNMT_TEMT PCMT TPMT DOT1 UPF0020 PrmA ADH_zinc_N RNA_bind_2
Motif
Other DBs
NCBI-ProteinID: ABV98190
UniProt: A8M274
Position
2684579..2685418
Genome map
AA seq 279 aa AA seqDB search
MSKVSSQPVPKAVGELYDRLTLSAMTDGTFNPNVHIGYWDSPESTASVDEAMDRLTDVFI
ERLKVGASNHVLDLGCGVGGPGLRVVAQTGARVTGISISEEQVKSANRLAAEAGVADRAV
FQHGDAMRLPFPDHSFDAVMALESMCHMPDRQQVLTEVCRVLVPGGRLVLTDVFERFPRK
EVRHQGIDKFCNDLMSTTADLDDYVAMLHRSGLRMRELLDVTEQTTLRLAYELAKLPVLQ
ERPAALNEGNFEFSDDAFKPSDLEGVDDFGCLLATAERP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagtgtcatctcagcccgtaccgaaagcggtcggcgagctgtacgaccgtctc
accctgagcgcaatgaccgacggtacgttcaacccgaacgtacacattggatactgggac
tcgccggagtcgacggcgtcggtcgacgaggcgatggaccggctgaccgacgtgttcatc
gagcgtttgaaggtcggcgcgtcgaaccacgttctcgatctgggctgcggggttggcggg
cccggcctgcgagtggtggcgcaaaccggcgcacgtgtcacgggcatcagcatcagcgag
gagcaggtcaaaagcgccaaccggctagcggccgaggcgggagtcgccgaccgcgccgtg
ttccagcacggcgacgcgatgcgactcccgttcccggaccattcgttcgacgcggtgatg
gctctggagtcgatgtgccacatgccggaccggcagcaggtgctcaccgaagtgtgccgg
gtgctcgtcccgggtggccggctcgttctgacggacgtgttcgagcgcttcccgcgtaag
gaagtccggcaccagggcattgacaagttctgcaacgatctcatgtccaccacggcggac
ctcgacgactacgtcgccatgctgcaccgttccggtctgcggatgcgcgagctgctcgac
gtgaccgaacagaccacgctgcgcctggcgtacgagttggccaaactgcccgtcctccag
gaacgccccgcggccctgaacgaaggcaacttcgagttctccgacgacgctttcaaaccg
tccgacctggaaggcgttgacgacttcggctgcctcctggcaacggcggaacgcccgtag

DBGET integrated database retrieval system