KEGG   Salinispora arenicola: Sare_2333Help
Entry
Sare_2333         CDS       T00613                                 

Definition
(GenBank) monooxygenase FAD-binding
  KO
K20077  flavin-dependent monooxygenase StaC [EC:1.13.12.-]
Organism
saq  Salinispora arenicola
Pathway
saq00404  Staurosporine biosynthesis
saq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Sare_2333
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.-  
     Sare_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO Lycopene_cycl FAD_binding_2 Pyr_redox_2 Pyr_redox_3 NAD_binding_8 Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABV98191
UniProt: A8M275
Position
2685508..2687118
Genome map
AA seq 536 aa AA seqDB search
MTNSGEWTDVLIVGGGPVGMALALDLRYRGIDCMVVEAGDGEVRHPKVSTIGPRSMELFR
RWGLADTIRNAGWPADHPLDIAWVTRVGGHEVHRYRRGTTANRGPYVHTPEPDQICPAHW
LNPLLQRAVGVHPTGPLRLRTTVDRVRQAADHVEATLVEDGSGRTGTVRAQFLVACDGAA
SPIRQACGIDAPPRHTTQVFRNILFRAPELKRQLGDRVALVYFLVRSSTLRFPMRSLNGS
DLYNLVVGVDAAAQVDGRSLITDAIAFDTPVELLSDSQWHLTHRVADSYRAGRVFLAGDA
AHTLSPSGGFGLNTGFGDVADLGWKLAAALNGWAGCHLLDTYEAERRPIALESLQEANLN
LQRTMRRHVPAEIHADGPAGEQARAEMAEQLVRGGAHREFDAPEIHFGLSYRSPAVISDP
LVPPRQGQPDAAWRPGSDPGYRAAHAWWDTETSTLDLFGHGFVLLSFTEGADVSAVERAF
AKRAVPLTVRRGSDPEIAKLYERSLVLVRPDGHVAWRGDELPADLGKFVDTIRGEY
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactccggcgagtggaccgacgtgctgatcgtgggcggcggcccggtcgggatg
gcgttggcactggacctgaggtaccgcggaatcgactgcatggttgtcgaagcgggcgac
ggcgaggtccggcaccccaaggtgagtacgatcggcccgcgctcgatggagctgtttcgc
cgttggggtctcgcggacaccatccgtaacgcgggatggcccgccgaccatcccctggac
atcgcctgggtcaccagagtcggtggccacgaggtgcaccggtatcggcggggcacgacg
gcgaaccgtgggccctacgtacacacccctgagcccgaccagatctgtccggcgcactgg
ctgaatccactgttgcaacgggccgtcggcgtgcaccccaccggtccactgcggctcagg
acgaccgtggaccgcgtgcgtcaggcggccgaccatgtcgaggccaccctcgtcgaggac
ggttccggaaggaccggcaccgtccgcgcacaattcctggttgcctgcgacggggctgcc
tcacccattcggcaggcctgcggcatcgacgcaccgccacgccacacgacgcaggtcttt
cggaacatcctcttccgtgccccggaactcaagcggcaactcggtgaccgcgtcgccctt
gtctacttccttgtgcggtcatccacattgcgcttccccatgcgctcgctcaacggcagt
gacctctacaacctggtcgttggtgtggacgctgccgctcaggtggatggcaggtcgttg
atcaccgatgccatcgccttcgacacaccagtggagctgctcagcgacagccagtggcat
ctcacgcaccgggtggccgacagctaccgagcgggacgggtcttcctcgcgggtgacgcc
gcccacacactctcgccctctggtggcttcgggctcaacaccggattcggcgatgtcgcc
gatctgggctggaagctcgccgccgcactgaacggctgggcggggtgccacctgctggac
acgtacgaagccgagcgcaggccgatcgccctggagagcctgcaggaggcgaacctcaac
ctgcaacgcaccatgcgccggcacgttccggccgagatccacgcggacggtccggcgggt
gaacaggctcgcgcggaaatggccgagcagctggtgcgcggcggagcgcatcgcgagttc
gacgcacctgagattcacttcgggctgtcctaccgatccccggccgttatctctgaccca
ctggtcccaccccgtcagggccagccggatgccgcctggcgcccgggcagcgatcccggc
taccgcgccgcgcatgcctggtgggataccgagacctccacactcgacctgttcggtcac
ggcttcgtcctgctgtcctttaccgagggggcagacgtgtctgccgtggagcgggcattc
gccaaacgagccgtaccgctgaccgttcgacgcgggagcgacccggagatagccaagctc
tacgagcgttctctcgtgctggttcgtcccgatggccatgtggcctggcgaggcgacgaa
ctgcccgctgatctggggaagttcgtcgacacgatccgaggcgaatattga

DBGET integrated database retrieval system