KEGG   Salinispora arenicola: Sare_2336Help
Entry
Sare_2336         CDS       T00613                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
saq  Salinispora arenicola
Pathway
saq00521  Streptomycin biosynthesis
saq00523  Polyketide sugar unit biosynthesis
saq00525  Acarbose and validamycin biosynthesis
saq01055  Biosynthesis of vancomycin group antibiotics
saq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sare_2336
   01055 Biosynthesis of vancomycin group antibiotics
    Sare_2336
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sare_2336
   00525 Acarbose and validamycin biosynthesis
    Sare_2336
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Sare_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind NAD_binding_10 NmrA
Motif
Other DBs
NCBI-ProteinID: ABV98194
UniProt: A8M278
Position
2688195..2689268
Genome map
AA seq 357 aa AA seqDB search
MRILVTGGAGFIGSHYVRSLLAGEYAAEDAVGAVDASVTVLDKLTYAGNRANLPATHPRL
TFVQGDICDQGLLRDLFKGHDAILHFAAESHVDRSVDGGATFVRTNALGTQSVLEAAVAV
GVPRVVHVSTDEVYGSIEHGAWTETWPLLPNSPYAASKASADLIARSYWRTHGLDVSITR
CSNNYGPYQHPEKLVPLFITNLLEGLPVPVYGTGVNVREWLHVADHCRALHRVLTRGRPG
EVYNVGSGNELTNLELTERLLHLCGADRSMIRYVTDRKGHDQRYSLDDTKIRECLGYRPR
VSFADGLAETVAWYRDNPQWWKAARHGAPKTTEAAPRATTGVVRGTHNRIDDQEPPK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtgaggatcctggtcaccggcggtgccggctttatcggctcacactatgtccggtccctg
ttggctggtgagtacgctgcggaggacgctgtcggagcggtggacgcctccgtcactgtc
ctggacaaactcacctacgccggcaatcgcgccaacctgccggccacccacccacgcctg
accttcgtgcagggtgacatctgcgaccagggactgctgcgggacctgttcaagggccat
gacgcgattctgcacttcgccgctgagtcacacgtggatcggtcggtcgacggtggagca
accttcgtacgcaccaatgcgttgggaacccagtcggtgctggaagccgctgtcgcggtc
ggcgtaccgcgggtcgtacacgtctcgaccgacgaggtctatggctccatcgaacacggg
gcgtggaccgagacgtggccgctgctgccgaactccccgtatgcggcttccaaggcgagc
gcggacctcatcgcccgttcctactggcgaacccatggcctggacgtttcgatcacccgc
tgttccaacaactacgggccctaccagcatccggaaaagctcgtcccgctgttcatcacc
aacctgctcgagggattgccggtgcccgtgtacggcaccggggtgaacgtgcgggagtgg
ctgcacgtggccgaccactgccgcgcactccaccgggtactcacccgagggcgtcccggt
gaggtctacaacgtgggcagcggaaacgagttgacgaacctggagctgaccgagcgcctg
ctccacctgtgcggcgcggaccgctccatgatccgttacgtcaccgaccgcaaggggcac
gaccagcggtactcccttgacgacaccaagatccgcgagtgtctcggttaccggccccgc
gtctccttcgccgatgggctggccgaaaccgtcgcctggtaccgcgacaacccacagtgg
tggaaggcggccaggcacggcgctcccaagaccaccgaggccgcgcctcgggcgaccacc
ggagtggtccgtggaacgcacaaccgtatcgacgaccaggagccaccaaaatga

DBGET integrated database retrieval system