KEGG   Salinispora arenicola: Sare_2352Help
Entry
Sare_2352         CDS       T00613                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 Sigma70_ECF HTH_24 HTH_AsnC-type HTH_23 HTH_38 HTH_Tnp_ISL3 HTH_29 HTH_11 HTH_10 HTH_28 HTH_40
Motif
Other DBs
NCBI-ProteinID: ABV98210
UniProt: A8M294
Position
complement(2707238..2707930)
Genome map
AA seq 230 aa AA seqDB search
MDPDGADPWRRPIRILVVDGQPLLRTGLRTVLGTEADLDVVAEASNGTEAVELTRRLLPD
VVLMDARTPPRAGVVATRAIVESGLPVRVLILTTSDFDAYVVGALRAGARGFLAKDVPSA
DLSAAIRAVAAGDAVVAPRILDRFLDHLAELLPDPAAGPTRLLDPLTGREREVLIQVARG
RSNAEIAQALSVSETTVKTHVGHVLTKLRLRDRVQAVVLAYESGLIRPRG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtggatcccgacggcgccgacccgtggcgacggccgatccgcatcctggtcgtcgacggc
cagccactgttacgcaccggcttacgtacggtgctcggcaccgaggcggacctcgacgtc
gtcgccgaggccagcaacggcaccgaggcggtggaactgactcgccggctgctgcccgac
gtggtgctgatggacgcacggacgccaccccgcgccggggtggtcgcgacccgggcgatc
gtcgagtccgggctgccggtgcgggtactgatcctcaccacctccgacttcgacgcgtac
gtggtgggtgcgctacgggccggggcgcgtggctttctcgccaaggacgtgccgtccgcg
gacctgtcggccgcgatccgcgcggtggccgccggggacgcggtggtggcgccccggatc
ctcgatcgatttctcgaccacctcgccgagttgctgcccgacccggcggcgggcccgacg
cggctcctcgacccgctgaccgggcgggaacgggaggttctgatccaggtcgcccgtggc
cggtcgaacgcggagatcgcccaggcgttgtcggtcagcgaaaccaccgtgaagacacac
gtcggtcacgttctgaccaagctgcggctacgcgaccgggtgcaggcggtggtgctggcg
tacgagtcggggctgatccgacctcggggctga

DBGET integrated database retrieval system