KEGG   Salinispora arenicola: Sare_2353Help
Entry
Sare_2353         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07465  putative RecB family exonuclease
Organism
saq  Salinispora arenicola
Brite
KEGG Orthology (KO) [BR:saq00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Sare_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDDEXK_1 Cas_Cas4 DUF2800
Motif
Other DBs
NCBI-ProteinID: ABV98211
UniProt: A8M295
Position
complement(2707942..2708853)
Genome map
AA seq 303 aa AA seqDB search
MTADPVTTQQLPPTAEVPATLRASLSPSRAADFKTCPLLYRFRSIDRLPEQPSVEQARGT
LVHAVLERLFDLPPAGRTPTAAGDLVAPQWERLVAEQPELAALFAADAEARAEFLRSATG
LLRGYFAVEDPRRLEPAERESLISAVVDEELLIRGYLDRLDVAPDGALRVVDYKTGGAPR
EAFEARALFQLKFYALVLWRTRGVVPRVLRLLYLKDAEVCDYAPDADELVRFERTVVALW
RAIEAATAAQDFRPRPSRLCDWCSHQRLCPSFGGTPPPFPVGSAPADPLPDARSRPTPPG
ADE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggatccggtgacgacccagcagctcccgcccacggcggaggtgcctgcgacg
ctacgggcttcgctgtccccctcgcgggcggccgacttcaagacctgcccgttgctctac
cggttccgcagcatcgaccggctacccgagcagcccagtgtggagcaggcgcggggcacc
ctggtccacgccgtgctggaacggctgttcgacctgcctcccgccgggcgcacgccgacc
gccgccggtgacctggtggctccgcagtgggaacggctggttgccgagcagccggagctg
gctgccctgttcgccgccgacgctgaggcccgcgcggagtttctgcgttcggccacgggg
ctgctacgcggctacttcgcggtggaggacccacgccgcctggagccggccgagcgggag
agtctcatctccgcggtggtcgacgaggagctgctgatccggggctacctggaccggctg
gacgtggccccggacggcgcgctgcgggtggtcgactacaagactggcggcgcacctcgg
gaggcattcgaggcgcgggcgctgttccagctcaagttctacgcgttggtgttgtggcgt
acccgcggggtggtgccacgcgtgctccggctgctctacctgaaggacgcggaggtctgc
gactacgctccggacgctgacgaactggtgcggttcgagcgcacagtggtggccctgtgg
cgggcgatcgaggcggccaccgccgcccaggactttcgcccgcggccaagccggctgtgt
gactggtgcagccaccagaggctgtgtccgagcttcgggggcacgccgccgccgttcccg
gtcgggtcggctccggccgacccgctgccggacgcgcggtcccgcccgacacccccgggc
gctgacgagtga

DBGET integrated database retrieval system