KEGG   Salinispora arenicola: Sare_2358Help
Entry
Sare_2358         CDS       T00613                                 

Definition
(GenBank) AAA ATPase central domain protein
  KO
K13527  proteasome-associated ATPase
Organism
saq  Salinispora arenicola
Pathway
saq03050  Proteasome
Module
saq_M00342  Bacterial proteasome
Brite
KEGG Orthology (KO) [BR:saq00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    Sare_2358
Proteasome [BR:saq03051]
 Prokaryotic proteasome
  Bacterial regulatory particles
   Sare_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prot_ATP_ID_OB AAA AAA_16 RNA_helicase AAA_2 AAA_22 CENP-F_leu_zip RuvB_N Cep57_CLD_2 IncA Laminin_II AAA_5 TIP49 Mg_chelatase Jnk-SapK_ap_N HAP1_N CALCOCO1 ADIP ATPase_2 AAA_23 NACHT SOGA Zeta_toxin AAA_14 Vir_act_alpha_C IstB_IS21 AAA_18 ATG16 RILP FAM76 DUF812 AAA_25 BCAS2 AAA_33 Med9 Parvo_NS1 DUF815 Mnd1 ABC_tran DUF3450 Fib_alpha NPV_P10 Rad17 AAA_24 BRE1 NB-ARC ZnuA DUF773 FUSC CEP63 Myosin_tail_1 Spc7 APG6 BST2 AAA_11
Motif
Other DBs
NCBI-ProteinID: ABV98216
UniProt: A8M2A0
Position
2712312..2714093
Genome map
AA seq 593 aa AA seqDB search
MARSDDADSRAARWEKEAHDLSTQVAFLQEELALVRRKLTESPRHVRQLEERLAAAQAQL
ARLTENNERLVSTLKEARAQIVTLKEEIDRLAQPPSGYGIFLERHDDGTVDVFTGGRKLR
VAVSPSLDVAELCRGQEVLLNDALNIVDAFGYERAGEVVMLKEVLAGPDGAPGDRALVVS
HSDEERVVHLAETLIGAAIRAGDSLMIEPRSAYAYERIPKSEVEELVLEEVPDVDYTDIG
GLHAQIEQIRDAVELPFLHADLFREHQLRPPKGILLYGPPGCGKTLIAKAVANSLAKKIA
ERRGEEKHTSYFLNIKGPELLNKYVGETERHIRLIFQRAREKAGEGTPVIVFFDEMDSVF
RTRGSGVSSDVENTIVPQLLSEIDGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKI
ERPDAEAAKDIFSKYILSGLPLHPDDLAEHGGEPQATVAAMIDAVVLRMYSETEENRFLE
VTYANGDKDVLYFKDFNSGAMIQNIVDRGKKMAIKEFLTSARKGLRLQHLLDACVDEFRE
NEDLPNTTNPDDWARISGKKGERIVYIRTLVSGGKGADAGRSIETASNTGQYL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgcagcgacgacgcggactcgcgcgccgcacggtgggagaaggaggcccacgat
ctctccacgcaggtcgcgttcctgcaagaggaactcgctctggtgcggcgcaagttgacc
gaaagcccccgacacgtccggcagctcgaagagcggctggctgccgcccaggcccagttg
gcgcggctgaccgagaacaacgagcggctcgtgagcaccctcaaggaggctcgggcgcag
atcgtgacgctcaaggaggagatcgaccgtctcgcccagccgccgagtggctacgggatc
ttcctggagcggcacgacgacggcacggtggacgtgttcaccggtggccgcaagctccgg
gtggccgtctcaccgtcgctggacgtcgccgagctgtgccgtgggcaggaagtcctgctc
aacgacgcgctcaacatcgttgacgcgttcggctacgagcgggccggtgaggtcgtcatg
ctcaaggaggtgctcgccggaccggacggcgcccccggcgaccgtgccctcgtggtctcc
cactccgacgaggaacgcgtcgtgcacctcgcggagaccctgatcggcgccgcgatccgg
gcgggagactcgctcatgatcgagccccgctcggcgtacgcgtacgagcggattccgaag
agtgaggtcgaggaactggtcctggaggaggtgccggacgtcgactacaccgacatcggc
ggcctccacgcgcagatcgagcagatccgcgacgcggtggagctgccgttcctgcacgct
gatctgttccgcgagcaccagctccggccgccgaagggcatcctgctctacggaccaccc
ggctgtggtaagaccctgatcgccaaggcggtggccaactcgctggcgaagaagatcgcc
gagcggcgcggcgaggagaagcacaccagctacttcctcaacatcaagggtcctgagctg
ctcaacaagtacgtcggcgagaccgagcggcacatccggctgattttccagcgcgcgcgg
gagaaggccggtgagggcacgccggtcatcgtgttcttcgacgagatggactcggtgttc
cgcacccgcggttccggcgtctcgtcggatgtggagaacaccatcgtcccgcagttgctc
agcgagatcgacggcgtcgagggcctggagaacgtcatcgtcatcggcgcctccaatcgg
gaggacatgattgacccggcgatcctgcggccgggccggcttgacgtcaaaatcaagatt
gagaggccggacgccgaggcggcgaaggacatcttctccaagtacatcctctccggactg
cccctgcatccggatgacctggccgagcacggtggtgagccacaggccaccgtggcggcg
atgatcgacgcggtcgtcctgcggatgtactcggagaccgaggagaaccgcttcctcgag
gtcacctacgccaacggcgacaaggatgtcctctacttcaaggacttcaactccggggcg
atgatccagaacatcgtggaccggggcaagaagatggccatcaaggagtttctcacctcc
gcccgcaagggcctgcggctgcaacacctcctcgacgcctgcgtcgacgagttccgggag
aacgaggacctgcccaacaccaccaaccctgacgactgggcgcgcatctccggcaagaag
ggcgagcggatcgtctacatccgcacgctcgtctccggcggcaagggcgccgacgcgggc
cggtccatcgagaccgccagcaacaccggtcagtacctctga

DBGET integrated database retrieval system