KEGG   Salinispora arenicola: Sare_2361Help
Entry
Sare_2361         CDS       T00613                                 

Definition
(GenBank) 20S proteasome A and B subunits
  KO
K03433  proteasome beta subunit [EC:3.4.25.1]
Organism
saq  Salinispora arenicola
Pathway
saq03050  Proteasome
Module
saq_M00342  Bacterial proteasome
Brite
KEGG Orthology (KO) [BR:saq00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    Sare_2361
Enzymes [BR:saq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     Sare_2361
Peptidases [BR:saq01002]
 Threonine Peptidases
  Family T1: proteasome family
   Sare_2361
Proteasome [BR:saq03051]
 Prokaryotic proteasome
  Core particles (20S proteasome)
   Sare_2361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proteasome
Motif
Other DBs
NCBI-ProteinID: ABV98219
UniProt: A8M2A3
Position
2716282..2717121
Genome map
AA seq 279 aa AA seqDB search
MAAAFDPSGRLPDLFTSAGTSSFSAFLSMAAPELLPGRRPLPPGTAADLTPHATTIVAIA
AAGGVVMAGDRRATMGNLIAQRDIEKVYPADAYSLVGMAGAAGIGIELIRLFQVELEHYE
KIEGAMLSLDGKANRLAAMVRGNLGAAMQGLAVVPMFAGFDLAANDPVKAGRIFSFDVTG
GPYEETGYDAVGSGSLFAKSALKKRFRVGLSVDDAMRLAVEALYDAADDDTATGGPDLTR
RIYPVVMTVTAEGTHRLTEAETAAIAENVVAGRMENPGG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcggcttttgatccatccgggcgtcttccggatctgttcaccagcgcggggacg
tcctccttctccgcgttcctgagcatggcggccccggagctgctgcccggacgacgtccg
ctgccgccggggacggccgcggacctgacgccgcacgccaccaccatcgtggccattgcc
gcggccggtggggtggtgatggccggtgaccgccgcgccaccatgggtaacctgatcgct
cagcgagacatcgagaaggtctacccggcggacgcgtactccctggtcggcatggcgggc
gccgccggaatcggcatcgagctgatccgactgttccaggtcgagctggagcactacgag
aagatcgagggagcgatgctctccctcgacggcaaggccaaccggctggccgcgatggtt
cgcggtaacctcggcgcggcgatgcaggggctcgccgtggtgccgatgttcgccgggttc
gacctggccgcgaacgacccggtcaaggctggccggatcttcagcttcgatgtgacgggc
ggcccgtacgaggagaccggttacgacgcggttggttccggctccctgttcgccaagtcg
gcgctgaagaagcggttccgggtcgggctctccgtcgacgacgcgatgcgtctggccgtg
gaggccctgtacgacgcggccgacgacgacaccgcgaccggtggcccggacctgacccgt
cggatctacccggtggtgatgaccgtcacggcggagggcacgcaccgactcaccgaggcg
gagacggcggcgatcgccgagaacgtggtcgctggccggatggagaacccgggcggctga

DBGET integrated database retrieval system