KEGG   Salinispora arenicola: Sare_2363Help
Entry
Sare_2363         CDS       T00613                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
saq  Salinispora arenicola
Pathway
saq00521  Streptomycin biosynthesis
saq00523  Polyketide sugar unit biosynthesis
saq00525  Acarbose and validamycin biosynthesis
saq01055  Biosynthesis of vancomycin group antibiotics
saq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sare_2363
   01055 Biosynthesis of vancomycin group antibiotics
    Sare_2363
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sare_2363
   00525 Acarbose and validamycin biosynthesis
    Sare_2363
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Sare_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABV98221
UniProt: A8M2A5
Position
complement(2718026..2719000)
Genome map
AA seq 324 aa AA seqDB search
MRILVTGGAGFIGSAYVRRLLSGSEPALRPDQVTVLDSFTYAGTDGSLGPVRDDPRLRVV
RGDVRDEDLVDATVAGHDAIVHFAAESHVDRSIASAAPFVSTNVGGTQVLLDAALRHRTG
RFLHVSTDEVYGSISQGTSPPSAPLNPSSPYSATKAAADLLALAYHRTHGLDVVITRGAN
NYGPYQHPEKLIPRFVTNLFEGHTLPLYGDGGDIRDWLHVDDHCHGIALAQRNGRAGAIY
HLGGGTALTNRDLTAALLDLFDVGWDRVTPVTDRKGHDRRYALDTTATRRDLGWAPAVAL
DRGLTATVRWYREHRAWWEPLVKA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatcctcgtcactggcggggctggcttcatcggctcagcgtacgtgcgccggctg
ctctccggctccgaacccgccctgcggccggaccaggtaaccgtgctcgactcgttcacc
tatgccggcaccgatggcagtctcggccccgtccgcgacgacccccgcctgcgtgtcgtc
cgtggtgatgtgcgcgacgaggatctggtcgacgccaccgtcgccggacacgacgccatc
gtccacttcgccgctgaatcccacgtggaccgctccatcgccagtgcggccccgttcgtc
agcaccaatgtgggcggcacccaggtcctgctcgacgccgcgctgcgtcaccgcaccggc
cgcttcctccacgtctccaccgatgaggtgtacgggtccatcagccagggcacgtcgccc
ccttccgcgccgctgaacccgagttccccgtactcggccaccaaggctgccgccgacctg
ttggccctggcctaccaccgcacccacggacttgacgtggtgatcacccggggtgccaac
aactacggtccctaccagcaccccgagaagctgatcccccgcttcgtcaccaacctgttc
gagggacacaccctgccgctgtacggcgacggcggcgacatccgcgactggctgcacgtg
gacgaccactgccacggaatcgcgctggcgcaacggaacggccgggccggggcgatctac
cacctcggcggcggcactgccctgaccaaccgggatctgaccgccgcgctgctcgacctg
ttcgacgttggttgggaccgggtgacaccggtgaccgaccgaaagggccacgaccgcagg
tacgccctcgacaccaccgcgacccgtcgcgacctcggatgggcaccagccgtcgccctc
gatcgaggcctgaccgccaccgtcaggtggtaccgggagcaccgggcctggtgggagccg
ctggtcaaggcgtag

DBGET integrated database retrieval system