KEGG   Salinispora arenicola: Sare_2388Help
Entry
Sare_2388         CDS       T00613                                 

Definition
(GenBank) apolipoprotein N-acyltransferase
  KO
K03820  apolipoprotein N-acyltransferase [EC:2.3.1.269]
Organism
saq  Salinispora arenicola
Brite
KEGG Orthology (KO) [BR:saq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sare_2388
Enzymes [BR:saq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.269  apolipoprotein N-acyltransferase
     Sare_2388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABV98246
UniProt: A8M2D0
Position
2744288..2745919
Genome map
AA seq 543 aa AA seqDB search
MPATAVETTQERRLPLPAAVVAAVVGGVLMLLAFPPYGVWPLAAVGVALLAAATHRRRPR
AGAGLGFLAGLALFAPLLSWTNLHTGYLPWVLLSLVQASYLALLGAASAWVSPLVDRFRW
GWPVLTGVLWVAQEALRDRTPFGGFPWGRLAFSQDASPLLRLAALGGAPLVTFAVAVVGG
LLVAAAWAGWAAYHRPGGRRSPGGWAPVAGWLAAALAVPVTGLLVPMRAAGDGDTVTVAI
VQGNVPRLGLDFNAQRQAVLNNHVEATVELAAQVASGARARPDLVVWPENSSDIDPLRDA
SAGGRIQAAADAVGVPILVGAVLRGPGPGQVRNAGLLWQPVTGPDLDQVYTKRHPVPFAE
YVPLRDIARLVSKQVDRVRSDFVPGTTPGVLAAGPAVLGDVICFEVAYDEVVRDTVTGGA
QLLVVQTNNATFDVAEARQQLAMVRLRAVEHGRPALMASTVGVSGFVSPDGRVSDATGFN
TRAIVVRQLHLADGRTLATRVGLWPEVVLTVLAVAALAAAGMRRRVRGGPTAGTPARGGH
NGA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgacggccgtggagacgacgcaggaacgccgcctaccgttgccggcggccgtg
gtggcggcggtcgtcgggggcgtgctgatgctgctggcgttcccgccgtacggggtgtgg
ccgctggcggcggtcggggtggccctgctggccgccgcgacgcaccgccgccgcccgcgt
gccggcgccggtctcgggttcctggctgggctggcactgttcgccccactactgagctgg
accaacctgcataccggttacctgccgtgggtgctgctgtcgctggtgcaggccagctac
ctggcgctgctcggcgcggcctccgcgtgggtttctccgctggttgaccggttccggtgg
gggtggccggtgttgaccggggtgctgtgggtggcgcaggaggcgctgcgggaccgcacc
ccgttcgggggtttcccgtggggtcggctggcgttcagccaggacgcgtcgccgctgctg
cggctggcggccctgggtggggcgccgctggtcaccttcgcggtcgcggtggtcggtggc
ctcctggtggccgccgcctgggcgggctgggcggcgtaccaccgccctggtgggcgccgg
tcgccgggtgggtgggcgccggtcgccgggtggctggcggccgcgctggcggtgccggtc
accgggttgctggtgccgatgcgcgccgccggtgacggggacacggtgaccgtggcgatc
gtgcagggtaacgtgccgcggctggggttggacttcaacgcccagcggcaggcggtgctg
aacaaccacgtcgaggccaccgtcgagctggccgcgcaggtggcctccggcgctcgggcc
cgccccgacctggtggtgtggccggagaactccagcgacatcgacccgctgcgggacgcc
tccgccggtgggcgcatccaggcggcagcggacgccgtcggggtgccgatcctcgtcggc
gcggtgctgcgcggccccggtccgggtcaggtacgcaacgcggggctgctgtggcagccg
gtgaccggccccgaccttgaccaggtgtacacgaaacgacacccggtgccgttcgccgag
tatgtgccgttacgtgacatagcccggctggtcagcaagcaggtggaccgggtgcgatcc
gacttcgtgccgggcaccacgccgggtgtgctggccgccggtcccgcggtgctcggtgac
gtcatctgcttcgaggtcgcctacgacgaggtggtccgggacaccgtcaccggcggggcg
cagctgctggtggtgcagaccaacaacgccaccttcgacgtggccgaggcccgtcagcag
ctggccatggtgcggctgcgggcggtcgagcacggccggccggcgctgatggcctcgacg
gtgggcgtttccgggttcgtctccccggacgggcgggtaagcgatgccaccgggttcaac
acccgcgcgatcgtggtgcgacagctgcacctcgccgacggacgcaccctcgcaactcgg
gtcgggttgtggccggaggtggtgctgacggtcctggccgtggcggccctggccgcagcg
gggatgcggcggcgtgtccgcggtggcccgacggccggtacgccggcgagaggggggcac
aacggtgcgtga

DBGET integrated database retrieval system