KEGG   Salinispora arenicola: Sare_2389Help
Entry
Sare_2389         CDS       T00613                                 

Definition
(GenBank) glycosyl transferase family 2
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
saq  Salinispora arenicola
Pathway
saq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:saq01003]
    Sare_2389
Enzymes [BR:saq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     Sare_2389
Glycosyltransferases [BR:saq01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   Sare_2389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ABV98247
UniProt: A8M2D1
Position
2745912..2746700
Genome map
AA seq 262 aa AA seqDB search
MRDETGHPGVGRVLVVIPTYNEADNLTWIVSRVRQAVPSVDILVADDNSPDGTGAVAEEL
AGQDRRVHVLHREGKQGLGAAYLAGFGWARRRGYDAVVEMDADGSHAPEDLPAMLTAARD
ADVVIGSRWTSGARVLNWPLRRLLLSRCGNLYARLALGMPVSDATGGYRVYRLSALDALD
LESVCSQGYSFQVELSRLAHRAGVRIVEVPITFAERERGRSKMSPLIVAEALWRITGWAV
ADRRLALRRGIHSTPTGQVRWP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgacgagaccggtcatccgggggtgggtcgggtgctggtggtgattccgacctac
aacgaggccgacaacctgacgtggatcgtgtcccgggtgcggcaggcggtgccgtcggtg
gacatcctggtcgccgacgacaacagcccggatggcaccggcgcggtcgccgaggaactc
gccgggcaggaccggcgggtgcacgtgctgcaccgggagggcaagcagggactcggggcc
gcgtacctggccgggttcgggtgggcccggcggcgcggctacgacgcggtggtggagatg
gacgccgacggttcgcacgccccggaggatctgccggcgatgctgaccgcggcccgggac
gcggacgtggtgatcggttcccggtggaccagcggggcgcgggtactcaactggccgctg
cggcggctgctgttgtcgcgctgcggcaacctgtacgcgcggctggccctgggcatgccg
gtgtccgacgccaccggcggataccgggtgtaccggctcagcgccctggacgcgttggac
ctggagtcggtgtgttcccaggggtactcgttccaggtggagctgtcccggctggctcac
cgggcgggcgtacgaatcgtggaggtgccgatcacgttcgcggagcgcgaacggggacgc
agcaagatgagcccgctgatcgtcgcggaggcgttgtggcggatcaccgggtgggcggtc
gccgaccggcggctggccctccggcggggtatccacagcacgcccacggggcaggtccgc
tggccgtag

DBGET integrated database retrieval system