KEGG   Salinispora arenicola: Sare_2390Help
Entry
Sare_2390         CDS       T00613                                 

Definition
(GenBank) FxsA cytoplasmic membrane protein
  KO
K07113  UPF0716 protein FxsA
Organism
saq  Salinispora arenicola
Brite
KEGG Orthology (KO) [BR:saq00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Sare_2390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FxsA
Motif
Other DBs
NCBI-ProteinID: ABV98248
UniProt: A8M2D2
Position
2746921..2747439
Genome map
AA seq 172 aa AA seqDB search
MRRGLRFVPLALLLAVLVELAVFLAVGRAVGFGAAVLAVFAASLLGMVLLRREGIRAWRG
FQAAAQAGQPPGPRVTDGVVGLIGALLLATPGLLSGVLGVLLLVPPVRRLARSGVRRTAE
RRVSSMVAGDLFGPRRVRVHRGAPQPQPPSAGPTAADGGQTIEGEIVEPRQG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggggactgaggttcgtaccgttggcgttgctgctggcggtgttggtggagctg
gcggtgttcctggccgtgggccgtgccgtcgggttcggggccgcggtgctggccgtgttc
gcggcgtcgctgctgggcatggtgctgttgcgccgggaggggattcgcgcgtggcggggc
ttccaggccgccgcgcaggccggtcaaccgccggggccgcgggtcaccgacggagtggtg
gggttgatcggtgcgctgctgttggccacaccgggcctgctcagcggcgtactgggggtg
ttgctgctggtgccgccggtgcgccggctggcccgttccggggtacggcgcacggccgag
cggcgggtgtcgtcgatggtcgcgggtgacctgttcgggccacggagggtgcgggtgcac
cggggtgccccgcagccgcagccgccgtctgcgggcccgaccgccgcagacggcggccag
accatcgagggtgagatcgtcgagccccggcagggctga

DBGET integrated database retrieval system