KEGG   Salinispora arenicola: Sare_2391Help
Entry
Sare_2391         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RbpA
Motif
Other DBs
NCBI-ProteinID: ABV98249
UniProt: A8M2D3
Position
complement(2747491..2747832)
Genome map
AA seq 113 aa AA seqDB search
MGERMLRGSRLGAVSYESDRNTELAPRQTREYLCAKGHQFEVPFAVDAEVPTTWECKFDG
SVARLVDGNEPEQKKAKPPRTHWDMLLERRSIAELEDILAERLKEVRTRRGRA
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcgcatgctgcgcggaagccgactgggggcggtcagctacgaatccgaccgt
aacaccgagctcgcgccgcgtcagacccgcgaatacctgtgcgccaagggccaccagttc
gaggtgccgttcgccgttgacgccgaggtcccgacgacctgggagtgcaagttcgacggc
agcgtcgcccggctggtcgacggcaacgagcctgagcagaagaaggccaagccgccgcgt
acccactgggacatgctgttggagcggcgatcgatcgccgaactggaggacattctcgcc
gaacggctcaaggaggtccgtacccgccgcggccgcgcctga

DBGET integrated database retrieval system