KEGG   Salinispora arenicola: Sare_2397Help
Entry
Sare_2397         CDS       T00613                                 

Definition
(GenBank) bifunctional deaminase-reductase domain protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C
Motif
Other DBs
NCBI-ProteinID: ABV98255
UniProt: A8M2D9
Position
complement(2753186..2754424)
Genome map
AA seq 412 aa AA seqDB search
MTSAHRATNSSILSALQELGTTWRWGSPPTLFTISHTPPKPTVPAVLAGSVGGHTPLGLL
EHWIDRCRRHRGIVHTQRDLGVNAVAISFEQDGQHVAYAMDRAGVQYLALGRQHASEWHL
TSGTDALAATLLPDLFTERLAELVWRLAGPPPPAPGSRIRDMWPTAGLLDLDEDELHERF
AVPPPTEGHTRLVAVASVDGLAAVHGSSTALTSTGDQRVYRLIKRDADLLLLGAATIRAE
RYGQTILSAPEVARRRANGLPPYPAVAVVTRSLDLDLTGPLFRRGTGRHTPPRPILIVPA
AAATDGNTAVAEHAEILVAGEHDVDLTRAVRLLQDRGHRRIVCEGGPSLAGQMAQADLLD
EICLTIAPQVLAVAGPRITADSATQPASGEWQLSRSLLDEVGNVFLRYARPS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagctcaccgtgccacgaatagttcgatcttgtctgccctgcaggaactcggc
accacctggcgctggggaagcccgccgacgctgttcacgatcagccacacgccgccaaaa
ccgaccgtgcctgctgttctcgccggcagcgtcggcgggcacaccccgctcggtctcctt
gagcactggatcgaccgttgtcgccgtcatcgcggcatcgtccacacgcaacgggacctg
ggggtcaacgccgtcgccatctcgttcgagcaggacggccagcacgtcgcctacgcgatg
gaccgcgccggtgtgcagtacctggcgctcggccgacaacacgcctccgaatggcacctc
accagcggcacggacgctctggcagccaccctccttcctgatctcttcaccgaacggctg
gccgagttggtctggcgactggccggtcccccgcccccggcgcccggctcccggatccgt
gacatgtggccgacagccgggctgctcgacctggacgaggacgaactccacgaacgcttc
gccgtgccgcccccgaccgagggccacacacgcctcgtcgcggttgccagtgtcgacggt
cttgccgcggtgcacggatccagtaccgcactgaccagcacgggcgaccagcgcgtctac
cggttgatcaagcgtgacgccgatctgctgctgttgggggcagcaacgatccgtgccgaa
cggtacgggcagaccatcctgtccgctcccgaggtcgcccgccgacgcgcgaacggccta
ccgccgtatccggccgtcgcggtagtcacccgcagtctcgatctcgacctgaccggcccg
ttgttccgacgggggacgggacgtcacactccgccccggccgatcctgatcgttcccgcc
gccgcggcaaccgacggcaacacggccgtggccgagcacgcggagatcctggtcgccggc
gagcacgacgtcgacctcacccgggcggtccggctgcttcaggacagggggcaccgacgc
atcgtctgcgagggcggcccttccctggccggccagatggcccaggcggacctgcttgac
gagatctgcctgaccatcgccccgcaggtgctggcggtggccggtccacggatcaccgcc
gactcggcgacacagccagcgtccggcgaatggcagctgagccggtccctcctcgacgag
gtggggaacgtgttccttcgctacgcccgtccctcgtag

DBGET integrated database retrieval system