KEGG   Salinispora arenicola: Sare_2398Help
Entry
Sare_2398         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABV98256
UniProt: A8M2E0
Position
complement(2754577..2755188)
Genome map
AA seq 203 aa AA seqDB search
MLVALIVACEVAFWLLLAAGLLARYPLRLPRVGAVLLLAVPAVDLVLLAATTIDLRRGGT
ATPAHGLAAAYLGFSVAFGHGLVRWADQRFAHRFAGGPPPSRAPQYGMARTRYEWRAWGR
GMLGWAVACALLLSGIVVVGDAERTQELWAWIGRLSLAMAAWLVFWPLAYTVFPKREPRG
SADDAAGRSGSRTAGTGHSRRLP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgtcgcgctgatcgtcgcctgcgaggtggccttctggctactgctcgcggccgga
ctcctggcccgctacccgcttcgtcttccccgcgtcggcgccgtgctgctgctggcggtc
ccggctgtcgacctcgtcctgctcgccgccacgacgatcgacctacgccgtggcggcacc
gccacgcccgctcacggcctcgccgcggcatacctcggtttctccgtggcgttcggtcac
ggactggttcgctgggctgatcaacggttcgcgcaccgcttcgccggaggaccgccaccg
tctcgggcaccgcagtacggcatggctcgtacccggtacgagtggcgcgcctggggcagg
ggaatgctcggctgggcggtggcctgcgcgttgttgctcagcggcatcgtcgtcgtcggt
gacgccgagcgaacccaggagctctgggcatggatcgggcggctcagcctggcgatggcg
gcctggctcgtcttctggccgctcgcgtacacggtgtttcccaaacgggaaccgcgtggc
tccgccgacgacgcggccgggcggagcggctcgcggactgcgggcaccggccactcccgg
cggttaccgtaa

DBGET integrated database retrieval system