KEGG   Salinispora arenicola: Sare_2400Help
Entry
Sare_2400         CDS       T00613                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABV98258
UniProt: A8M2E2
Position
complement(2756098..2757087)
Genome map
AA seq 329 aa AA seqDB search
MKAVMFDAYGPPDVLTHVDVPTPVPRADQVLIRVHATTVTSAEVGMRRGEPRWGRVIIGL
RRPRRGVRVLGLEFAGDVTAVGPAVRRLRAGDRVFGFTSFGAGANAEYKCLSERASITTM
PDNVAYAQAAAAVDGFTTAWHFLHDLAKVQPGQRVLVIGASGSIGTYAIQLAKYLGAVVH
GVCSGRNAKLVESLGADRVFDYTVEDFTTSGERYSAIFDTVGRSSFARCRSVLAPRGCYL
PTTGLVVNAMLTAGTALTTGPRVRTGMSVGKQAALDALRGLLGQDRLQVVIDRIYPMAEI
VEAHRYVDEGHKVGNVVIDVVGDGRRNEP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggtgatgttcgacgcgtacggcccacccgacgtgctcacccacgtggacgtg
ccgactccggtgcctcgggccgatcaggtgctgatccgggtgcacgccacgacagtgacc
tctgctgaggtgggaatgcgccgaggagaaccgcgctgggggcgggtcatcatcggtctt
cgccgcccgcgcaggggcgtgcgggtactcgggttggagttcgctggcgacgtcacggcg
gtcgggccggcggtgcgtcggttacgggccggcgaccgggtcttcggcttcaccagtttc
ggggctggcgcgaacgccgagtacaagtgcctgtcggaacgggcctcgatcaccacgatg
ccggacaacgtggcctatgcgcaggctgccgcagccgtcgatggcttcaccaccgcctgg
cacttcctgcatgatcttgccaaagtccaacccggacagcgagtgttggtcatcggtgcc
tccggcagcatcggtacctacgccatccagctagccaagtaccttggcgcagtcgtacac
ggcgtgtgtagcggccggaacgcgaagctggtcgaatcgctcggcgctgatcgggtcttc
gactacaccgttgaggacttcaccaccagcggcgagcgctacagcgcgatcttcgacacg
gtgggccgcagttcgttcgcccggtgtcgatcggtgctggcgccacgtggttgttacctg
ccgacgaccggtctggtggtgaacgccatgctcaccgccggcaccgcactgaccaccggc
ccacgggtacgcaccggcatgtcggtgggcaaacaggcggccctggacgccctgcgggga
ctactcggccaggaccgccttcaggtcgtgatcgaccgcatctatccgatggccgagatc
gtcgaggcgcaccggtacgtcgacgagggccacaaggtcggcaacgtcgtgatcgacgtc
gtgggcgacggtcgccggaacgagccctga

DBGET integrated database retrieval system