KEGG   Salinispora arenicola: Sare_2414Help
Entry
Sare_2414         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABV98271
UniProt: A8M309
Position
2779471..2780082
Genome map
AA seq 203 aa AA seqDB search
MNTILRRSVLGIAGLALSTGVVAGPLATDNNNTTTPTTSMPADSAVAVSVAQAAKPDMDI
LIPHGTQGEQSRISLGDEQVSNVKAIIEATKKAGMDERAAVVAIATSLQESKLENLGHLG
DRNDHDSQGLFQQRPSSGWGTVEQITDPEYSTTAFLEGLKQVEGWQDMPLTEAAQTVQVS
AYPFHYAQWETQAADLVAEHWTS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgattctgcgtcgtagcgtcctcggtattgctggtctggccctgtccaccggc
gtcgtcgccggccccctggccaccgacaacaacaacaccaccacccccaccaccagcatg
ccggcggactcggctgtcgcggtgagcgtggcgcaggccgcgaagccggacatggacatc
ctgattccgcatggcactcagggtgagcagtcgcgtatcagcctgggtgacgagcaggtg
tcgaatgtgaaggcgatcatcgaggccacgaagaaggccggtatggacgagcgtgccgcc
gtggtggcgatcgccaccagtttgcaggagtcgaagctggagaacctgggacacctgggt
gaccgtaacgaccacgactcgcagggcctgttccagcagcgcccgtcctccggctggggc
accgtggagcagatcaccgaccccgagtactccaccaccgccttcctggagggtttgaag
caggtcgagggctggcaggacatgcccctgaccgaggccgcccagacggtgcaggtgtcg
gcgtacccgttccactacgcccagtgggaaacccaggccgctgacctcgtcgccgagcac
tggaccagctga

DBGET integrated database retrieval system