KEGG   Salinispora arenicola: Sare_2418Help
Entry
Sare_2418         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MauE
Motif
Other DBs
NCBI-ProteinID: ABV98274
UniProt: A8M312
Position
2783801..2784235
Genome map
AA seq 144 aa AA seqDB search
MWLRAVLGAILTAMGLGQLVSWPAMPDILAAYRIGPAVVLPWMAAVLILAELAGGLWLLT
RPRSCALTPVWIYTGVAVTWAGLAVQAFARDLPVDNCGCFGRFLTQRLGWFVLVQDALLL
IYAGVLLRATRKARARAAAATSAR
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtggcttcgtgctgtcctgggggccatcctcacggcaatggggttaggccagctcgtt
tcgtggccggcaatgccggacatcctcgccgcgtatcggatcgggcccgcggtggtgctg
ccatggatggccgcggtgttgatcctggcggaactggccggcgggctctggctgctgacc
cgaccacgttcctgcgcactgaccccggtctggatctacacgggggtggcggtgacatgg
gccggcctggcggtgcaggcgttcgcccgtgacctgccggtcgacaattgcggctgcttc
ggacgcttcctgacccagcggctcggctggttcgtactggtccaggacgcactgttgctg
atctacgcgggagtgctgctgcgcgccacccggaaggcccgggcacgggcagcagcagcc
acgtcggcacgctga

DBGET integrated database retrieval system