KEGG   Salinispora arenicola: Sare_2419Help
Entry
Sare_2419         CDS       T00613                                 

Definition
(GenBank) protein serine/threonine phosphatase
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR PP2C_2 PP2C MerR-DNA-bind
Motif
Other DBs
NCBI-ProteinID: ABV98275
UniProt: A8M313
Position
2784333..2785400
Genome map
AA seq 355 aa AA seqDB search
MGLLTIGAFAQAARLTPKALRLYDQVGLLPPAAVDPESGYRLYGPDQLPLARLIAQLRRI
GMPLATIRVVCGLDPAAAAETIKAYWQQVTADTAARARLAAVLVDHLSRGETTVSHTNRN
LAVRYAAGCDTGLVRDSNEDAAYASDQLFAVADGMRGHGGAAASAAAIDVLKVLERVDAP
AADLLTMLGNAITNADRTIRGLATDDHQPVTTLTALLRSGSQLALVHVGDTRVYLLRGGA
LALLTQDHTWVQTEVDQGRLDRDQAAVHPQRALLVRALGSGQQVEVDLALRTALPGDRYL
LCSDGLSAIVGRGCLHSTLSASDDPERTVQRLIELARAEGAPDNIACVVVDIAEA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggggttgttgaccatcggggcgttcgctcaggcagcgcgactgaccccgaaggcattg
cgcctgtacgaccaggttgggcttctgccgccggctgcggtcgaccccgagtccggatac
cggctctacggcccggaccagctgccgttggcgcggctgattgcccagttgcgtcgcatt
ggcatgccgctggcgacgatccgcgtcgtgtgtggcctcgatccggctgcggcggcggaa
acgatcaaggcgtactggcagcaggtcaccgccgacacggcagctcgcgctcggcttgcc
gccgtcctcgtggaccatctatcacgaggggagaccaccgtgtctcacacgaatcgcaac
ctggccgttcgctacgccgccggttgtgacaccgggcttgtacgtgacagcaacgaggac
gccgcgtacgccagcgatcaactgttcgcggtcgcggacggtatgcgaggacatggcggt
gccgcggccagcgcagccgccatcgacgtcctcaaggtgttggaacgtgtcgacgcaccc
gcagccgacctgctgacgatgctgggcaatgccatcacgaacgccgaccggaccatccgc
gggctcgccaccgatgatcaccagccggtcaccaccctgaccgcgctgctgcgcagcggc
tcccagttggccctggtccacgtcggcgacacccgggtctacctgctgcggggcggcgcg
ctcgcgctgctcacccaggaccacacctgggtgcagaccgaagtcgatcaaggaaggctc
gaccgagaccaggccgccgtgcatccccagcgcgccctgctggtccgtgctctcggcagc
ggccagcaggtcgaggtcgatctcgcgctacgcaccgcgttgcccggtgaccggtatctg
ctgtgctccgatgggctgtccgccattgtcggccgcggctgcctgcactcgacgttgagt
gcttcagacgatccagagcgcacggtgcaacggctgatcgaactggctcgagccgaaggg
gcaccggacaacatcgcctgtgtcgtcgtcgacatcgccgaggcgtaa

DBGET integrated database retrieval system