KEGG   Salinispora arenicola: Sare_2428Help
Entry
Sare_2428         CDS       T00613                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 FAD_binding_2 Lycopene_cycl HI0933_like Pyr_redox_3 DAO Thi4 NAD_binding_8 FAD_binding_3 FAD_oxidored Pyr_redox AlaDh_PNT_C Trp_halogenase GIDA
Motif
Other DBs
NCBI-ProteinID: ABV98283
UniProt: A8M321
Position
complement(2791114..2792016)
Genome map
AA seq 300 aa AA seqDB search
MSEHDVVIVGGGAAGLSAALVLGRARRRVAIVDAGEPRNAPARHMQGFLSRDGMPPAELL
AAGRAEVTGYGVELVVGTVDRIEPGFAVQLGGGRMLAARRVLVATGLRDEIPDIPGLRQR
WARTVLHCPYCHGYEVRDRPLGVIASAEHALLVCQWSPDVVYFPHTSTVSDEDRARLTAR
GVRIVEGEVARIADGEAQMADGTTVDRQAFFVRPRFVPTSNLLSDLGAAVDAGGWAVVDS
TGRTSVPGVWAAGNAVDPRAQVITAAGQGSAAAIAINNDLVNDDIAQALTVLGPDPEPTF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacatgacgtggtgatcgtgggcggcggcgccgccgggctgagcgcggcactg
gtcctgggccgggcacgtcgcagggtggcgatcgtcgacgcaggcgagccgcgcaatgcc
ccggcgcggcacatgcagggtttcctgtcgcgtgacggcatgccgccggcggaactgctc
gcggcgggccgggcagaggtgaccgggtacggcgtcgagctcgtcgtcggcacggtcgac
cggatcgaacccggtttcgccgtccaactcggcggcggtcgaatgctggccgcccgaagg
gtcctggtggccaccggcctgcgcgacgagatccccgatattccgggccttcgccagcga
tgggcgcgaacagtgctgcactgcccgtactgtcacggctacgaagtccgcgaccggccc
ctcggtgtcatcgcctcggcggagcacgccctgctggtctgccagtggtcgcctgatgtc
gtctacttcccgcacaccagcaccgtcagcgacgaggaccgggccaggctgaccgcccgc
ggcgtgcgcatcgtcgaaggcgaggtcgcccgcatcgccgacggggaggcgcagatggcc
gacgggaccaccgtcgaccggcaggcgttcttcgtccgtccgcgcttcgtgccgacctcg
aacctgctgtccgacctcggcgccgccgtagacgccggcggctgggccgtcgtcgactca
accgggcgcaccagcgtgcctggcgtgtgggctgccggcaacgctgtcgacccgcgcgcg
caggtgatcaccgccgcggggcagggttccgccgccgcgatcgccatcaacaacgacctc
gtcaacgacgacatcgcacaagccctcacggtgctcgggcctgacccggaaccgactttc
tga

DBGET integrated database retrieval system