KEGG   Salinispora arenicola: Sare_2448Help
Entry
Sare_2448         CDS       T00613                                 

Definition
(GenBank) FAD linked oxidase domain protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_4 BBE
Motif
Other DBs
NCBI-ProteinID: ABV98295
UniProt: A8M333
Position
2808288..2809718
Genome map
AA seq 476 aa AA seqDB search
MATAAVALNSLAGELTGTLLLPGDPDFVTCRLPFVSRPDEVLPRAVVRCATTADVATALT
FARAHRIPIAVRSGGNSFADRSSTDGLLVDLGGMRNMRMDGDLMVADPGVRIRDVRRRLN
PGDRAISCGWCPEVALGGAVLGGGYGSLSRLYGLGCDHLVAAEVVLADGRTAWCDADREP
DLFWALRGAGGGLTGAVTSLVLATRPAVPATFVECRWPIRHAARVIGAWQRFAPEAPDEI
NIETVLVSAHGEEPMVAVYGVSAAGTAFLDRLGPDPDHVEIRELPGPAAALVSYPDVPED
IDVSGPSWGIRPGLRLARSEFFDGELPEAAIESLVDYLVARPVVDQSRILEFIPWGGAIA
RMAPDATAFVHRRARFILKHAAWVMRRASDELRRDARRWVDGSWEISHPWGSGLIYPNYP
EPTRAPLDPAYHGTNLARLRRVLARYDPDGTFAADHRRTGRPRAADLLGRGLPDGC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggccacagccgctgtcgcactgaacagcctcgccggggaactgaccggcacgttactg
ctgcccggcgatccggacttcgtcacctgccggctgccgtttgtgtcccgccccgacgag
gtactgccccgggcggtggtgcggtgtgccaccaccgccgacgtggcaacagcgctcacc
ttcgcccgagcccaccggatcccgatcgcggtgcgcagcggcgggaacagcttcgccgac
aggtccagcaccgacgggctgctcgtcgacctcggcgggatgcggaacatgcggatggac
ggtgatctgatggtcgcggacccgggggtgcgcatccgcgacgtacgccgccggctcaac
cccggtgaccgggcgatctcctgcggatggtgcccggaggtggcactcggcggtgcggtg
ctcggcggcgggtacggcagcctgtcccggttgtacggcctcggctgcgaccacctggtc
gccgccgaggtggtgttggccgacggtcgcacggcctggtgcgacgcggatcgtgaacct
gacctgttctgggcgctgcggggcgccggcggtgggctcaccggcgcggtcacctcgctc
gtactggccacccgtccggccgtgccggcgacctttgtcgagtgtcggtggccaatacgg
catgccgcacgcgtcatcggcgcttggcaacgattcgcaccagaggcacccgacgagatc
aacattgagaccgtgctggtctcggcgcacggcgaagagccgatggtcgccgtgtacggc
gtcagcgccgcaggtaccgccttccttgaccggctcggtcccgaccccgatcacgtcgag
atccgggagctgccggggccagccgccgccctggtcagctacccggacgtgcccgaggac
atcgacgtgtcaggcccttcctgggggatccggccagggctgcgcctcgcccggtcggag
ttcttcgacggcgagctacccgaggccgccatcgagtcgctcgtggactacctggtagcc
aggccagtcgttgatcagtcgcggattctggagttcattccgtggggcggcgcgatcgcc
cgaatggcgccggatgccaccgcgttcgtgcaccggcgggcacggttcattctcaagcac
gcggcgtgggtgatgcgccgcgccagcgacgagctgcgccgggacgcgcggcgatgggtc
gacggatcctgggagatctcgcacccttggggatccggactgatctaccccaactacccg
gaaccgactcgggcgccactcgaccccgcctaccacggcaccaacctggcccgcctgcgc
cgcgtcctggcccgctacgacccggacggcaccttcgccgcggaccaccgccggactggg
cggccgcgcgctgccgatctcctcggccgtggtctgcccgacggctgttga

DBGET integrated database retrieval system