KEGG   Salinispora arenicola: Sare_2630Help
Entry
Sare_2630         CDS       T00613                                 

Definition
(GenBank) ABC transporter related
  KO
K11084  2-aminoethylphosphonate transport system ATP-binding protein
Organism
saq  Salinispora arenicola
Pathway
saq02010  ABC transporters
Module
saq_M00302  2-Aminoethylphosphonate transport system
Brite
KEGG Orthology (KO) [BR:saq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Sare_2630
Transporters [BR:saq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   2-Aminoethylphosphonate transporter [MD:M00302] [OT]
    Sare_2630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 Rop AAA_30 AAA_22 TOBE_2 AAA RsgA_GTPase Mg_chelatase AAA_18 AAA_28 AAA_33 NACHT AAA_23 DUF87
Motif
Other DBs
NCBI-ProteinID: ABV98469
UniProt: A8M4Q1
Position
complement(2995794..2996930)
Genome map
AA seq 378 aa AA seqDB search
MSESPAVQFDRVSVRYGQVTALRDFSLDVAVGETVALLGPSGSGKSTALKALAGFVRPTS
GRVLLNGHDVTGAPPHKRGLGVVVQQYALFPHLTVADNIAFGLRARRVRRAESARRVEEM
LDLVGMDRYGRRYPRELSGGQQQRVAIARALAIRPPVLLLDEPLSALDAQLRADMLDELR
QLRDELPDVAMLYVTHDQTEALTLAHRIAVMREAELLDLDTAQGLYRQPPSEFTAAFLGG
ANLLPATVRDVNGTVQVGAVTITATAPGPLTPGARVRLAVRPHTIGVRTDGPGLAAVLTG
LQWRGANYRLTCLIDGLDEPGGLSVHVDVPSIDGLPQVGSPVRVGLPEHGAAVVARTGAG
VPTGGAANAVAQDLAGVA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagtcgccggcggtccagttcgaccgcgtcagcgtccgctacgggcaggtcacg
gcgctgcgggacttctcgctcgacgtagccgtcggcgagacggtggccctgctcggcccc
tccgggtcgggcaagtcaaccgccctcaaagcgctggccggattcgtccggccgacatcc
ggccgggtcctgctcaacggacatgacgtcaccggggcaccaccgcacaagcgtgggctc
ggcgtggtggtgcagcagtacgccctcttcccgcacctcaccgtcgccgacaacatcgcg
ttcggcctgcgtgcccggcgggtgcgacgcgccgagtcagcccgacgtgtcgaggagatg
cttgatctggtcggcatggatcgttacggccgccgctacccgcgggagctctccggcggg
cagcaacagcgggtggcgatcgcccgcgcgttggcgatccggccgccggtgctgctgctc
gacgagccactgtccgccctcgacgcgcagctgcgcgccgacatgctcgacgagctgcgt
cagcttcgagacgagcttccggacgtcgcgatgctctacgtcacccacgaccagaccgag
gcgctcaccctggcgcaccggatcgctgtcatgcgcgaggccgaactgctcgacctggac
accgcccagggcctctaccggcagccaccgagcgagttcaccgccgccttcctgggtggg
gcgaacctgctgccagccaccgttcgtgatgtcaacggcacggtccaggtgggtgcggtc
accatcaccgccaccgcccccgggccgctcactcccggcgcccgcgtccggctcgcggtc
aggccacacaccatcggggtacgcactgacggacccggcctcgcggccgtcctcaccggc
ctgcagtggcggggtgccaactaccggctgacctgcctgatcgacgggctcgacgagccc
ggcgggctcagcgtgcacgtcgacgtgcccagcatcgacgggctcccgcaggtcggctcc
ccggtacgggtcgggttgccggagcatggcgccgcggtggtggccaggacgggcgcgggt
gtccccaccgggggcgccgccaacgccgttgcccaggacctggcaggtgtggcatga

DBGET integrated database retrieval system