KEGG   Salinispora arenicola: Sare_3928Help
Entry
Sare_3928         CDS       T00613                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
saq  Salinispora arenicola
Pathway
saq00860  Porphyrin and chlorophyll metabolism
saq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sare_3928
Enzymes [BR:saq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Sare_3928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO DJ-1_PfpI GATase
Motif
Other DBs
NCBI-ProteinID: ABV99719
UniProt: A8M1Q8
Position
complement(4472019..4473746)
Genome map
AA seq 575 aa AA seqDB search
MSGGLLVAGTTSDAGKSVLTAGICRWLHRRGVRVAPFKAQNMSNNSAVVVGPDGRGGEIG
RAQAMQAAACGLAPDLRFNPVLLKPGSDRTSQVVLLGEAVDTLTTGTFRQLRPRLADTAY
AALADLRATHDVVICEGAGSPAEINLRAGDYVNMGLARHAGLPAIVVGDIDRGGVFASMF
GTVALLEPADQALVAGFVINKFRGDPSLLAPGLDMLRQVTGRPTYGVLPWALDLWLDAED
SLAYGRVLGRPAAPRGSDWLDVAVVRLPRISNATDVEALATEPGVRVRLTVEPAELAAAD
LVVLPGSKSTVADLDWLRQSGLADAVLAHAAAGRPLLGVCGGFQMLGRLIHDPVESRRGS
VPGLGLLPVEVTFDPCKTVRRSAGIGWDAEPVGGYEIHHGYVSAAAPDLAPLFAYHDGTG
EGAVAGSVYGTHWHGAFESDGFRRRFLARVARQAGRHGFQVAPDTSFAGARERSLDLLGD
LVEEHLDTAGLWRLIESGPSPGLPFIPPGAPDAGPRTGSGAPDTEPADREPGTAAGRGPG
SVANVGGAVGDRESGIPPGVHSSDDIGGSVQAERA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgggctgctggtcgccggcaccacctcggacgccggcaagagcgtactcacc
gccgggatctgtcgatggctgcaccggcggggcgtgcgggtggcgccgttcaaggcgcag
aacatgtccaacaactcggccgtggtggtcggcccggacggacgcggcggagagatcgga
cgggcccaggcgatgcaggcggcggcctgtgggctggcaccggatctgcggttcaatccc
gtgctgctcaagcccggcagcgaccggaccagccaggtggtgctgctcggtgaggcggtc
gacacactcaccaccggtacgttccgtcagcttcgaccccgtctcgccgataccgcgtac
gcggcgctggctgacctgcgggcgacccacgacgtggtgatctgcgagggggcaggcagc
ccagcggagatcaacttacgggccggggactacgtcaacatggggctggcccggcacgca
ggcctgcccgcgatcgtggtcggcgacatcgaccgcgggggtgtcttcgcctcgatgttt
ggcaccgtagccctgctggagccggccgaccaggcgctggtcgccggattcgtcatcaac
aagttccgcggtgacccgagcctgttggccccgggcctggacatgctgcgtcaggtcacc
gggcggcccacgtacggcgtgctgccctgggcgctcgacctctggctggacgcggaggac
tcgcttgcgtacgggcgggtactcggccgcccggccgccccccgtggcagtgactggctg
gatgtggccgtggtacggctgcctcggatcagtaacgccaccgatgtcgaggcactcgcc
accgagccgggcgtgcgggtgcgcctcaccgtcgagccagccgagctcgccgccgccgac
ctggtcgtgctgcccgggtccaagtcgaccgtggcggacctggactggcttcggcagtcc
ggcctcgccgatgccgtgctcgcccacgccgccgccgggcggcctctgctcggtgtctgc
ggcgggttccagatgctcgggcgtctcatccacgatccggtggagagtcggcggggcagc
gtacccggcctggggctgctgccggtcgaggtcaccttcgacccgtgcaagacggttcgc
cgatctgccggcatcggctgggatgccgagccggtcggcggctacgagatccaccatggg
tacgtctcggccgccgcccccgacctcgcgccgctgttcgcctaccacgacggcaccggt
gagggcgcggtcgccggatcggtgtacggcacccactggcacggggcgttcgagtccgac
gggttccgccgccggttcctggcccgggtggcacgtcaagccggacggcacggtttccag
gtcgccccggacacctccttcgccggtgctcgcgaacgctccctggacctgctcggcgat
ctggtcgaggagcacctggacacggccgggctgtggcggctgatcgagtccggcccgtca
ccgggcctgccgttcatcccgccgggcgcgccagacgcggggccccggaccgggagcggc
gcgccagacacggagcccgcggaccgggagccggggacagccgcgggcaggggcccgggt
tcagtggcgaacgtcggcggggcggtcggtgaccgggagtccggcatcccgccaggcgtc
cactcctccgatgacatcggtggctcggtgcaggccgagcgcgcgtag

DBGET integrated database retrieval system