KEGG   Salinispora arenicola: Sare_4203Help
Entry
Sare_4203         CDS       T00613                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
saq  Salinispora arenicola
Pathway
saq00020  Citrate cycle (TCA cycle)
saq00640  Propanoate metabolism
saq00660  C5-Branched dibasic acid metabolism
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
saq01120  Microbial metabolism in diverse environments
saq01130  Biosynthesis of antibiotics
saq01200  Carbon metabolism
Module
saq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sare_4203
   00640 Propanoate metabolism
    Sare_4203
   00660 C5-Branched dibasic acid metabolism
    Sare_4203
Enzymes [BR:saq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sare_4203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABV99984
UniProt: A8M469
Position
complement(4770144..4771322)
Genome map
AA seq 392 aa AA seqDB search
MDLYEYQGRDLFERHGLPVLAGGVATTPEEARAIAERLGGRVVVKAQVKVGGRGKAGGVK
LAEGADETVARATDILGMDIKGHTVHKVMITVTADVAEEYYFSYLLDRANRTFLCIASVA
GGMDIEQVAAETPEKVVKAPIDANTGVDAAMARQIITRAGFPAEVVDQAVEVAVDLWKAF
VAEDATLVEVNPLARTGQGGLLLLDAKVSLDENAAFRHPDHEALVDQAAVDPLEQAAKEK
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGERHGGVKPANFLDIGGGASAAVMANGLE
IVLSDPSVKSVFVNVFGGITACDAVANGIVQALALLEQRGEKVTRPLVVRLDGNNAEAGR
AILDGANNPLIQRVDTMDGAAERAAELAAAGV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtacgagtaccaggggcgagacctgttcgagcggcatgggttgcccgtgctc
gccggcggcgtcgccacgaccccggaggaggcccgcgcgatcgccgaacgcctcggcggt
cgggtggtcgtcaaggcgcaggtgaaggtcggtggccggggcaaggccggcggggtgaag
ctggccgagggcgcggacgagacggtggcccgggccaccgacatccttggcatggacatc
aaggggcacaccgtccacaaagtcatgatcaccgtgaccgcggacgtggccgaggagtac
tacttctcctacctgttggaccgggcgaaccgcaccttcctctgcatcgccagtgtcgcc
ggtgggatggatatcgagcaggtggccgccgagacgccggagaaggtcgtcaaggcgccg
atcgacgcgaacaccggcgtcgacgcggcgatggcccggcagatcatcactcgggccggc
ttcccggctgaggtcgtcgatcaggccgtcgaggtcgcggtggacctgtggaaggcattt
gtcgccgaggatgcgacgctggtcgaggtgaacccgctcgccagaaccggccagggtggg
cttctcctcctcgatgccaaggtgagcctggacgagaacgcggcgttccggcacccggac
cacgaggcgttggtcgaccaggccgcggtggacccgctggagcaggccgccaaggagaag
gacctcaactacgtcaagctcgatggtgaggtcggcatcatcggcaacggcgccggactg
gtcatgtcgaccctggacgtggtcgcatacgccggggagcgacacggcggcgtcaagccg
gcgaacttcctcgacatcggtggcggggcgagcgccgcggtgatggccaacggtcttgag
atcgtgctctccgacccctcggtgaagagcgtgttcgtcaacgtcttcggcgggatcacc
gcctgcgatgcggtcgccaacggcatcgtgcaggcgctggcgttgctcgagcagcggggc
gagaaagtcaccaggccgctggtcgtccgcctcgacggcaacaacgccgaggccggccgg
gcgattcttgacggcgcgaacaatccgctgatccagcgggtcgacacgatggacggtgcg
gccgagcgggccgccgaactggccgctgcgggggtctga

DBGET integrated database retrieval system