KEGG   Salinispora arenicola: Sare_4247Help
Entry
Sare_4247         CDS       T00613                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
saq  Salinispora arenicola
Pathway
saq00473  D-Alanine metabolism
saq01100  Metabolic pathways
saq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sare_4247
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Sare_4247
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saq01011]
    Sare_4247
Enzymes [BR:saq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Sare_4247
Peptidoglycan biosynthesis and degradation proteins [BR:saq01011]
 Precursor biosynthesis
  Racemase
   Sare_4247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABW00029
UniProt: A8M4B3
Position
complement(4819147..4820265)
Genome map
AA seq 372 aa AA seqDB search
MWQAEVRVDLDAIRENVSWLRSGSAAELMAVVKGDGYGHGMVPAALAALDGGADWLGVCT
LDEALTLRREGITAPILAWLLAPGLPLHEGVAAGIDLGAASVAQLDEMVQAGRTAGRPAR
LHLKIDTGLSRGGATVSDWPGLLTAAAKAQADGTVEVVGVWSHFVYADAPGHPTTDRQLA
VFHEGLDMVEKAGLRPRYRHLANSAATLTRPDAHFDLVRPGLAVYGLSPVAGESFGLRPA
MTARARVMLTKQVPAGAGVSYGHTYTTERDSTLAVIPLGYADGVPRSASNSGPVHLGGVR
RTISGRVCMDQFVLDCGDDPVAPGDVAVLFGSGRNGEPTADDWAEAVGTINYEIVTRFGS
TRVPRSYDGERP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggccgaggtacgcgtcgaccttgacgcgatccgtgagaacgtgagttggctg
cgatccggtagcgccgccgagctgatggcggtggtcaagggcgacgggtacggccacggc
atggtcccggccgccctggccgcgctggacggtggcgccgactggctcggtgtctgcacc
ctcgacgaggcactcacgctgcgccgggaggggatcaccgcgccgatcctggcctggctc
ctcgccccgggcctgccgttacacgaaggtgtggcggccgggatcgacctcggcgcggcc
agtgtggcgcagctggacgagatggtgcaggcgggccggaccgccggccgtccggcccgg
ctgcacctcaagatcgacactgggctgtcccggggtggcgccaccgtctcggactggccg
gggctgctcaccgccgccgcgaaggcgcaggccgacggtacggtcgaggtggtcggggtg
tggagccacttcgtgtacgcggacgcgcccggccacccgacgaccgaccggcagctcgcc
gtcttccacgagggcttggacatggtggagaaggcggggctgcgtccgcgttaccgccac
ctggccaactcggcagccacgctgacccggccggatgcccacttcgacctggtccggccc
gggctggccgtctacggcctgtctccggtggccggcgagagcttcgggctgcggccggcg
atgaccgcccgcgcccgcgtcatgctcaccaagcaggtcccggcgggcgccggggtctcc
tatggccacacctataccaccgagcgggacagcaccctcgccgttattccgctcgggtac
gccgacggggtgccccggagcgcgtccaacagcggcccggtgcacctgggtggcgtccgg
cgcaccatctccggccgggtctgcatggaccagttcgtgctcgactgcggcgacgatccg
gtggcgccgggggacgtggccgtcctgttcggcagtgggcggaacggggagccaacagcc
gacgactgggccgaggcggtcggcacgatcaactatgagatcgtcacccgattcggcagt
acgcgggtgccccgtagctacgacggcgagcgtccgtga

DBGET integrated database retrieval system