KEGG   Salinispora arenicola: Sare_4310Help
Entry
Sare_4310         CDS       T00613                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
saq  Salinispora arenicola
Pathway
saq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:saq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Sare_4310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:saq03011]
    Sare_4310
Ribosome [BR:saq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Sare_4310
  Bacteria
    Sare_4310
  Archaea
    Sare_4310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABW00092
UniProt: A8M524
Position
complement(4875479..4875937)
Genome map
AA seq 152 aa AA seqDB search
MPGKGDAPVLPGARAVARYVRISPMKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKV
LASAIANAENNERLDPDALLVSEAYVDEGPTMKRFQPRAQGRAYRIRKRTCHITVVVEAV
APAAPTKAASKKAAPAKQTTPAATESKTEGAE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgccaggaaagggcgacgctccggtgctcccgggcgcgcgggcggttgcgcggtacgtg
cgcatctcgccgatgaaggcgcgccgggtggtcaacctcgtccgcggcctgcccgcgaag
gaggcgctcacggtgctgcagttcgcgccacaggccgcgagcgagcaggtgtacaaggta
ctcgcgagcgcgatcgccaacgcggagaacaacgagcggctggaccccgacgcgctgctc
gtcagcgaggcgtacgtggacgagggcccgacgatgaagcggttccagccgcgcgcccag
gggcgggcgtaccggatccggaagcgtacgtgtcacatcacggtggtggttgaggcggtg
gcgccggccgcgccgacgaaggcggcgtcgaagaaggcggctccggccaagcagaccacg
ccagctgcgaccgagagcaagacggagggtgccgagtaa

DBGET integrated database retrieval system