KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0217
Entry
SAR0217           CDS       T00182                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00620  Pyruvate metabolism
sar00640  Propanoate metabolism
sar00650  Butanoate metabolism
sar01100  Metabolic pathways
sar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAR0217
   00640 Propanoate metabolism
    SAR0217
   00650 Butanoate metabolism
    SAR0217
Enzymes [BR:sar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     SAR0217
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 zf-C2HCIx2C
Other DBs
NCBI-ProteinID: CAG39244
GeneDB: SAR0217
UniProt: Q6GK90
Position
252576..254825
AA seq 749 aa
MLETNKNHATAWQGFKNGRWNRHVDVREFIQLNYTLYEGNDSFLAGPTEATSKLWEQVMQ
LSKEERERGGMWDMDTKVASTITSHDAGYLDKDLETIVGVQTEKPFKRSMQPFGGIRMAK
AACEAYGYELDEETEKIFTDYRKTHNQGVFDAYSREMLNCRKAGVITGLPDAYGRGRIIG
DYRRVALYGVDFLMEEKMHDFNTMSTEMSEDVIRLREELSEQYRALKELKELGQKYGFDL
SRPAENFKEAVQWLYLAYLAAIKEQNGAAMSLGRTSTFLDIYAERDLKAGVITESEVQEI
IDHFIMKLRIVKFARTPDYNELFSGDPTWVTESIGGVGIDGRPLVTKNSFRFLHSLDNLG
PAPEPNLTVLWSVRLPDNFKTYCAKMSIKTSSIQYENDDIMRESYGDDYGIACCVSAMTI
GKQMQFFGARANLAKTLLYAINGGKDEKSGAQVGPNFEGINSEVLEYDEVFKKFDQMMDW
LAGVYINSLNVIHYMHDKYSYERIEMALHDTEIVRTMATGIAGLSVAADSLSAIKYAQVK
PIRNEEGLVVDFEIEGDFPKYGNNDDRVDDIAVDLVERFMTKLRSHKTYRDSEHTMSVLT
ITSNVVYGKKTGNTPDGRKAGEPFAPGANPMHGRDQKGALSSLSSVAKIPYDCCKDGISN
TFSIVPKSLGKEPEDQNRNLTSMLDGYAMQCGHHLNINVFNRETLIDAMEHPEEYPQLTI
RVSGYAVNFIKLTREQQLDVISRTFHESM
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgttagaaacaaataaaaatcatgcaacagcttggcaaggatttaaaaatggaagatgg
aacagacacgtagatgtaagagagtttatccaattaaactacactctttatgaaggtaat
gattcatttttagcaggaccaacagaagcaacttctaaactttgggaacaagtaatgcag
ttatcgaaagaagaacgtgaacgtggcggcatgtgggatatggacacgaaagtagcttca
acaatcacatctcatgatgctggttatttagacaaagatttagaaacaattgtaggtgta
caaactgaaaagccattcaaacgttcaatgcaaccattcggtggtattcgtatggcgaaa
gcagcttgtgaagcttacggttacgaattagacgaagaaactgaaaaaatctttacagat
tatcgtaaaacacataaccaaggtgtattcgatgcatattctagagaaatgttgaactgc
cgtaaagcaggtgtaatcactggtttacctgatgcatacgggcgtggacgtattatcggt
gactatcgtcgtgtagctttatatggtgtagatttcttaatggaagaaaaaatgcacgac
ttcaacacgatgtctacagaaatgtcagaagatgtaattcgtttacgtgaagaattatca
gaacaatatcgtgcattaaaagaattaaaagaacttggacaaaaatatggtttcgattta
agccgtccagcagaaaacttcaaagaagcagttcaatggttatacttagcataccttgct
gcaattaaagaacaaaacggtgcagcaatgagtttaggtcgtacatcaacattcttagat
atctatgctgaacgtgaccttaaagcaggtgttattactgaaagcgaagttcaagaaatt
attgaccacttcatcatgaaattacgtattgttaaatttgctcgtacacctgattacaat
gaattattctctggagacccaacttgggtaactgaatctatcggtggtgtaggtattgac
ggacgtccacttgttacgaaaaactcattccgtttcttacactcattagataacttaggt
ccagcaccagaaccaaacttaacagtattatggtcagtacgtttaccagacaacttcaaa
acatactgtgcaaaaatgagtattaaaacaagttctatccaatatgaaaatgatgacatt
atgcgtgaaagctatggcgatgactatggtatcgcatgttgtgtatcagcgatgacaatt
ggtaaacaaatgcaattcttcggtgcacgtgcgaacttagctaaaacattactttacgct
atcaatggtggtaaagatgaaaaatctggtgcacaagttggtccaaacttcgaaggtatt
aacagcgaagtattagaatatgacgaagtattcaagaaatttgatcaaatgatggattgg
ctagcaggtgtttacattaactcattaaatgttattcactacatgcacgataaatacagc
tatgaacgtattgaaatggcattacatgatacagaaattgtacgtacaatggcaacaggt
atcgctggtttatcagtagcagctgactcattatctgcaattaaatatgcacaagttaaa
ccaattcgtaacgaagaaggtcttgtagtagactttgaaatcgaaggcgacttccctaaa
tacggtaacaatgacgaccgtgtagatgatatcgcagttgatttagtagaacgctttatg
actaaattacgtagtcataaaacatatcgtgattcagaacatacaatgagtgtattaaca
attacttcaaacgttgtatacggtaagaaaactggtaacacaccagacggacgtaaagct
ggcgaaccatttgcaccaggtgcaaacccaatgcatggccgtgaccaaaaaggtgcatta
tcttcattaagttctgtagctaagattccttacgattgctgtaaagatggtatttcaaat
acattcagtatcgtaccaaaatcattaggtaaagaaccagaagatcaaaaccgtaactta
actagtatgttagatggttacgcaatgcaatgtggtcaccacttaaatattaacgtattt
aaccgtgaaacattaatagatgcaatggaacatccagaagaatatccacagttaacaatc
cgtgtatctggttacgctgttaacttcattaaattaacacgtgaacaacaattagatgta
atttctcgtacattccatgaaagtatgtaa

DBGET integrated database retrieval system