KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1515
Entry
SAR1515           CDS       T00182                                 

Definition
(GenBank) hypothetical phage protein
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
SSDB
Motif
Pfam: Phage_connect_1
Other DBs
NCBI-ProteinID: CAG40513
GeneDB: SAR1515
Position
complement(1610434..1610712)
AA seq 92 aa
MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIAR
DYESRGYSNDQSRSKVFNEKGLQKMILKLKKW
NT seq 279 nt   +upstreamnt  +downstreamnt
atgagtttagaagaaattaaattgtggttgagaattgactataatttcgaaaatgattta
attgaaggtctcattcaatcggctaagtctgaattactattaagtggggttccagattat
gacaaagatgacttggaatacccgcttttttgtacagcgattaaatatatcattgcaaga
gattatgaaagtcgtggatactcaaatgaccaatctagaagcaaggtgtttaatgaaaaa
ggattgcaaaaaatgattttgaaattaaaaaagtggtag

DBGET integrated database retrieval system