KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2355
Entry
SAR2355           CDS       T00182                                 

Gene name
moaE
Definition
(GenBank) putative molybdopterin-synthase large subunit
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00790  Folate biosynthesis
sar01100  Metabolic pathways
sar01240  Biosynthesis of cofactors
sar04122  Sulfur relay system
Module
sar_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAR2355 (moaE)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAR2355 (moaE)
Enzymes [BR:sar01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     SAR2355 (moaE)
SSDB
Motif
Pfam: MoaE AhpC-TSA
Other DBs
NCBI-ProteinID: CAG41336
GeneDB: SAR2355
UniProt: Q6GEG3
Structure
PDB: 
2Q5W 2QIE

Position
complement(2427268..2427714)
AA seq 148 aa
MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
IWKKEIWEDGSKWQGHQKGNYEEAKREE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaacaatttgaaatcgtgacagaaccgatacaaacagaacaatatcgtgaattcact
ataaatgaatatcaaggtgcagtagttgtttttaccggtcatgttcgcgaatggactaaa
ggcgtcaaaacggaatatttagaatatgaagcgtatattccaatggctgaaaagaaattg
gcacaaattggagatgaaataaatgaaaaatggcctggaacgataacgagtattgttcat
agaatagggccattacaaatttcagatatcgctgtattaattgcagtttcttcaccgcat
cgtaaagatgcctatcgagcaaatgaatatgcaattgagcgtatcaaagaaattgttccg
atttggaaaaaagaaatttgggaagatggttcaaaatggcaaggacatcaaaaagggaat
tatgaagaagcgaagagggaggaataa

DBGET integrated database retrieval system