KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0192Help
Entry
SAR0192           CDS       T00182                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07106  N-acetylmuramic acid 6-phosphate etherase [EC:4.2.1.126]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00520  Amino sugar and nucleotide sugar metabolism
sar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SAR0192
Enzymes [BR:sar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.126  N-acetylmuramic acid 6-phosphate etherase
     SAR0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS_2 SIS RCC1
Motif
Other DBs
NCBI-ProteinID: CAG39219
GeneDB: SAR0192
UniProt: Q6GKB5
Position
219704..220603
Genome map
AA seq 299 aa AA seqDB search
MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQLTKVIKKTIAQYKK
GGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMTMAVEGAEDHKKLAE
EDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFANTIGATTVSISCNEHAVISEIAQYPVE
VKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMIDVKATNQKLIDRSVRI
IQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLNNGDIVKRAIRDRQP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgatggaaaatagtacgaccgaagcgcgtaatgaagcgacgatgcatcttgatgaaatg
actgtggaagaggcattaattacgatgaataaagaagatcagcaagtcccgttagcagtt
cgaaaggcaataccacaattgacaaaagtaattaaaaaaacaattgcacagtataaaaag
ggtggacgattgatctatatcggtgcaggtacaagtggacgattgggtgtcttagatgca
gcggagtgtgtacctacattcaatactgatcctcatgaaattataggtattattgctggt
ggacaacatgctatgacgatggctgtagaaggtgcggaagatcacaaaaaattagcggaa
gaagatttgaaaaatatagatttaacatcaaaagatgtcgttataggaattgccgcgagt
ggcaaaacgccatatgttataggcggtttaacatttgctaatacaatcggtgctacaaca
gtatctatttcatgcaatgaacatgcagttataagtgaaattgcgcagtatccagtagaa
gttaaagttggtccagaagtattaactggttcaacgcgtttaaagtctggtacagcacaa
aaattaattttaaatatgatttcaaccatcacaatggttggtgtcggaaaagtttacgat
aacctcatgattgatgttaaagcaaccaatcaaaaactgatcgaccgttcagtgcgtatt
attcaagaaatatgtgctatcacatatgatgaagcaatggcgttatatcaggtatctgag
catgatgtgaaagttgcgacagttatgggtatgtgtggcatttctaaggaagaagcaaca
agacggttattaaacaatggtgacattgttaaacgagcaatcagagatagacaaccttag

DBGET integrated database retrieval system