KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0351Help
Entry
SAR0351           CDS       T00182                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00071  Fatty acid degradation
sar00072  Synthesis and degradation of ketone bodies
sar00280  Valine, leucine and isoleucine degradation
sar00310  Lysine degradation
sar00362  Benzoate degradation
sar00380  Tryptophan metabolism
sar00620  Pyruvate metabolism
sar00630  Glyoxylate and dicarboxylate metabolism
sar00640  Propanoate metabolism
sar00650  Butanoate metabolism
sar00900  Terpenoid backbone biosynthesis
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01120  Microbial metabolism in diverse environments
sar01130  Biosynthesis of antibiotics
sar01200  Carbon metabolism
sar01212  Fatty acid metabolism
sar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAR0351 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    SAR0351 (thl)
   00640 Propanoate metabolism
    SAR0351 (thl)
   00650 Butanoate metabolism
    SAR0351 (thl)
  Lipid metabolism
   00071 Fatty acid degradation
    SAR0351 (thl)
   00072 Synthesis and degradation of ketone bodies
    SAR0351 (thl)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAR0351 (thl)
   00310 Lysine degradation
    SAR0351 (thl)
   00380 Tryptophan metabolism
    SAR0351 (thl)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAR0351 (thl)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAR0351 (thl)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAR0351 (thl)
Enzymes [BR:sar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAR0351 (thl)
Exosome [BR:sar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAR0351 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: CAG39374
GeneDB: SAR0351
UniProt: Q6GJW4
Position
395237..396418
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPAIMGIAPVDAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgttgtcactaaggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatcctgctattatgggtattgccccagttgacgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagtgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system