KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0581Help
Entry
SAR0581           CDS       T00182                                 

Definition
(GenBank) putative ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00071  Fatty acid degradation
sar00072  Synthesis and degradation of ketone bodies
sar00280  Valine, leucine and isoleucine degradation
sar00310  Lysine degradation
sar00362  Benzoate degradation
sar00380  Tryptophan metabolism
sar00620  Pyruvate metabolism
sar00630  Glyoxylate and dicarboxylate metabolism
sar00640  Propanoate metabolism
sar00650  Butanoate metabolism
sar00900  Terpenoid backbone biosynthesis
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01120  Microbial metabolism in diverse environments
sar01130  Biosynthesis of antibiotics
sar01200  Carbon metabolism
sar01212  Fatty acid metabolism
sar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAR0581
   00630 Glyoxylate and dicarboxylate metabolism
    SAR0581
   00640 Propanoate metabolism
    SAR0581
   00650 Butanoate metabolism
    SAR0581
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAR0581
   00072 Synthesis and degradation of ketone bodies
    SAR0581
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAR0581
   00310 Lysine degradation
    SAR0581
   00380 Tryptophan metabolism
    SAR0581
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAR0581
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAR0581
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAR0581
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sar04147]
    SAR0581
Enzymes [BR:sar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAR0581
Exosome [BR:sar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAR0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAG39601
GeneDB: SAR0581
UniProt: Q6GJ93
Position
635261..636400
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYGVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGELFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFDHGLLFKDGVTVGVDSNLPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKESM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgctcaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggctcaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatt
caagccggagctggcaaggtatatattgcaggcggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaaccgcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtagcc
aagatgtatggtgtttcaagagaattacaagatgaatttgcttaccgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaactattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttctattgcttattatggaaaaagatatggcatacgaattaggtttcgat
catggtttattatttaaagatggtgttacggtaggtgttgattctaatttacctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtggttgcctgccaacaagcttta
aatatttcgaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgacgcgattattttatatgtttgacaaagagagtatg
attgcatctatggggattgggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system