KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0670Help
Entry
SAR0670           CDS       T00182                                 

Definition
(GenBank) putative sensor histidine kinase protein
  KO
K19077  two-component system, OmpR family, sensor histidine kinase GraS [EC:2.7.13.3]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar01503  Cationic antimicrobial peptide (CAMP) resistance
sar02020  Two-component system
Module
sar_M00725  Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon
sar_M00726  Cationic antimicrobial peptide (CAMP) resistance, lysyl-phosphatidylglycerol (L-PG) synthase MprF
sar_M00730  Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter
Brite
KEGG Orthology (KO) [BR:sar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAR0670
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SAR0670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sar01001]
    SAR0670
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sar02022]
    SAR0670
   01504 Antimicrobial resistance genes [BR:sar01504]
    SAR0670
Enzymes [BR:sar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SAR0670
Protein kinases [BR:sar01001]
 Histidine kinases
  OmpR family
   SAR0670
Two-component system [BR:sar02022]
 OmpR family
  GraS-GraR (cationic antimicrobial peptide transport)
   SAR0670
Antimicrobial resistance genes [BR:sar01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SAR0670
   Cationic antimicrobial peptide (CAMP) resistance, lysyl-phosphatidylglycerol (L-PG) synthase MprF [MD:M00726]
    SAR0670
   Cationic antimicrobial peptide (CAMP) resistance, VraFG transporter [MD:M00730]
    SAR0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_3 HATPase_c_2 PapA_C
Motif
Other DBs
NCBI-ProteinID: CAG39687
GeneDB: SAR0670
UniProt: Q6GJ10
Position
715951..716991
Genome map
AA seq 346 aa AA seqDB search
MNNLKWVVYFLKSRKNWIFWILFLNILMLGISLIDYDFPIDSLFYIVSLNLSLTLIFLIL
TFFKEVKLYRHFEKDKEIEEIKHKDLAETPFQRHTVDYLYRQILAHKDKVVDQQLQLNMH
EQTITEFVHDIKTPVTAMKLLIDQEENQERKQALLFEWSRINSMLDTQLYITRLESQRKD
MFFDYVSLKRMVIDEIQLTRHISQVKGIGFDIDFKVDNHVYTDIKWCRMIIRQILSNALK
YSENYNVDISTELIDQHVALIIKDHGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL
VDSVKDQLGIQLQVTSTIGKGTTVKLIFPLQNEIVERMSEVTNLSF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttgaaatgggtagtttattttctgaaatcaagaaagaattggatattttgg
atactgtttttaaatattcttatgttaggcattagtcttattgactatgactttccaatc
gatagtttgttttatattgtttctttaaatttaagcttaacactgatttttcttatattg
actttttttaaagaagtaaaattatatagacattttgaaaaagataaagaaatcgaagaa
ataaaacataaagatttagcggaaaccccattccaacgtcatacagttgattatttatat
cgtcaaattttagcgcataaagataaagtggtcgaccaacagttgcaattaaacatgcat
gaacaaaccatcacagaatttgtgcacgacatcaaaacaccagtgactgctatgaaattg
ttaattgaccaagaagagaatcaagaaagaaaacaagcgctattatttgaatggtcacgt
attaactcgatgttagatacgcaattgtatattacgagattagagtcgcaacgtaaagat
atgttttttgattatgtctcattgaagcgcatggttattgatgaaattcaattaacaagg
catataagtcaagttaaaggtatcggatttgatattgattttaaagtggataatcatgtg
tacacggatataaaatggtgtcgtatgattattagacagattttatcaaatgctttgaaa
tatagtgagaattataatgttgatatttcaacggaattaattgatcaacatgttgcgtta
atcatcaaggatcatggaagaggtattagtaaaaaagatatgcctcgaatatttgaacgt
gggtttacgtcaacggctaacagaaatgaaacgacatcatccggcatgggtctatactta
gtggatagtgtgaaagatcaattaggaatacaattacaagttacttcgactattggaaaa
ggaacaacggttaaattgatcttcccattacaaaatgaaattgttgagcgcatgtcagaa
gtgacaaatctgtcattttaa

DBGET integrated database retrieval system