KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR0978Help
Entry
SAR0978           CDS       T00182                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00061  Fatty acid biosynthesis
sar00780  Biotin metabolism
sar01100  Metabolic pathways
sar01130  Biosynthesis of antibiotics
sar01212  Fatty acid metabolism
Module
sar_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAR0978 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAR0978 (fabI)
Enzymes [BR:sar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SAR0978 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SAR0978 (fabI)
Lipid biosynthesis proteins [BR:sar01004]
 Fatty acid synthase
  Component type
   SAR0978 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CAG39983
GeneDB: SAR0978
UniProt: Q6GI75
Structure
PDB: 

Position
1022267..1023037
Genome map
AA seq 256 aa AA seqDB search
MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcttgaaaacaaaacatatgtcatcatgggaatcgctaataagcgtagtatt
gcttttggtgtcgctaaagttttagatcaattaggtgctaaattagtatttacttaccgt
aaagaacgtagccgtaaagagcttgaaaaattattagaacaattaaatcaaccagaagcg
cacttatatcaaattgatgttcaaagcgatgaagaagttattaatggttttgagcaaatt
ggtaaagatgttggcaatatcgatggtgtatatcattcaatcgcatttgctaatatggaa
gacttacgcggacgtttttctgaaacttcacgtgaaggtttcttgttagctcaagacatt
agttcttactcactaactatcgttgctcatgaagctaaaaaattaatgccagaaggtggt
agcattgttgcaacaacatatttaggtggcgaattcgcagttcaaaactataatgtgatg
ggtgttgctaaagcgagtttagaagcaaatgttaaatatttagcattagacttaggtcca
gataatattcgcgttaatgcaatttcagctggtccaatccgtacattaagtgcaaaaggt
gtgggtggtttcaatacaattcttaaagaaatcgaagagcgtgcacctttaaaacgtaat
gttgatcaagtagaagtaggtaaaacagcggcttacttattaagtgatttatcaagtggc
gttacaggtgaaaatattcatgtagatagcggattccacgcaattaaataa

DBGET integrated database retrieval system