KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1102Help
Entry
SAR1102           CDS       T00182                                 

Gene name
isdB
Definition
(GenBank) iron-regulated heme-iron binding protein
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NEAT YSIRK_signal Gram_pos_anchor Proton_antipo_C
Motif
Other DBs
NCBI-ProteinID: CAG40104
GeneDB: SAR1102
UniProt: Q6GHV7
Structure
PDB: 

Position
complement(1146876..1148834)
Genome map
AA seq 652 aa AA seqDB search
MNKQQKEFKSFYSIRKSSLGVASVAISTLLLLMSNGEAKAAEETGVTNTEAQPKTEAVAS
PTTTTTEKAPEAKPVAKPVANAVSVSNKEVVAPTTETKEAKEVKAVKEVKAPKEAKEEKP
AAKADNNTYPILNQELREAIKNPAIKDKDHSAPNSRPIDFEMKKKDGTQQFYHYASSVKP
ARVIFTDSKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYDTVKDYAYIRFSVSNGTKA
VKIVSSTHFNNKEEKYDYTLMEFAQPIYNSADKFKTEEDYKAEKLLAPYKKAKTLERQVY
ELNKIQDKLPEKLKAEYKKKLEETKKALDEQVKSAITEFQNVQPTNEKMTDLQDTKYVVY
ESVENNESMMDAFVKHPIKTGMLNGKKYMVMETTNDDYWKDFMVEGQRVRTISKDAKNNT
RTIIFPYVEGKTLYDAIVKVHVKTIDYDGQYHVRIVDKEAFTKANADKTNKKEQQDNSAK
KETTPAMPSKPTTPPVEKESQKQDSQKDDNKQSPSVEKENDASSESGKDKMPVTKPAKAE
VESSSTTPTKVVSTTQNVAKPTTASSETTKDVVQTSAGSSEAKDSAPLQKANIKNTNDGH
TQSQNNKNTQENKAKSLPQTGEESNKDMTLPLMALIALSSIVAFVLPRKRKN
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacagcaaaaagaatttaaatcattttattcaattagaaagtcatcactaggc
gttgcatctgtagcgattagtacacttttattattaatgtccaatggcgaagcaaaagca
gctgaagaaacaggtgttacaaatacagaagcacaaccaaaaactgaagcagttgcaagt
ccaacaacaacaacaactgaaaaagctccagaagctaaaccagtagctaaaccagtagct
aatgctgtctcagtatctaataaagaagttgtggcccctactactgaaacaaaagaagct
aaagaagttaaagcagttaaagaagttaaagcccctaaggaagcaaaagaggaaaaacct
gcagcaaaagctgacaacaatacatatcctattttgaatcaggaactaagagaagcgatt
aaaaaccctgcaataaaagacaaagatcatagcgcaccaaactctcgtccaattgatttt
gaaatgaaaaagaaagatggcactcaacagttttatcattatgcaagttctgttaaacct
gctagagttattttcactgattcaaaaccagaaattgaattaggattacaatcagggcaa
ttttggagaaaatttgaagtttatgaaggtgacaaaaagttgccaattaaattagtatca
tacgatactgttaaagattatgcttacattcgcttctctgtttcaaatggaacaaaagca
gttaaaatcgtaagttcaactcacttcaataacaaagaagaaaaatacgattacacatta
atggaattcgcacaaccaatttataacagtgcagataaattcaaaactgaagaagattat
aaagctgaaaaattattagcgccatataaaaaagcgaaaacactagaaagacaagtttat
gaattaaataaaattcaagataaacttcctgaaaaattgaaagctgaatacaagaagaaa
ttagaagagacgaaaaaagctttagatgaacaagtgaaatccgcgataactgaattccaa
aatgtacaaccaacaaatgaaaaaatgaccgatttacaagatacaaaatatgttgtttat
gaaagtgttgagaataacgaatctatgatggatgcttttgttaaacaccctattaaaaca
ggtatgcttaatggcaaaaaatatatggtaatggaaactactaatgacgattactggaaa
gatttcatggttgaaggtcaacgtgttagaacaattagcaaagatgctaaaaataacact
agaacgattatcttcccatatgttgaaggtaaaactctatatgatgctatcgttaaagtt
cacgtaaaaacgattgattatgatggacaataccatgtcagaatcgttgataaagaagca
tttactaaagccaatgccgataaaactaataaaaaggaacaacaagacaactcagctaag
aaggaaactactccagctatgcctagcaaaccaacaacaccacctgttgaaaaagaatca
caaaaacaagacagccaaaaagatgacaataaacaatcaccaagtgttgaaaaagaaaat
gacgcatctagtgagtcaggtaaagacaaaatgcctgttacaaaaccagctaaagctgaa
gtagaatcaagtagtacaactccaactaaggtagtatctacgactcaaaatgttgcaaaa
ccaacaactgcttcttcagaaacaacaaaagatgttgttcaaacttcagcaggttctagc
gaagcaaaagatagtgctccattacaaaaagcaaacattaaaaacacaaatgatggacac
actcaaagccaaaataataaaaatacacaagaaaataaagctaaatcattaccacaaact
ggtgaagaatctaataaagatatgacattaccattaatggcattaatagctttaagtagt
atcgttgcattcgtattacctagaaaacgtaaaaactaa

DBGET integrated database retrieval system