KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1326Help
Entry
SAR1326           CDS       T00182                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00260  Glycine, serine and threonine metabolism
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01120  Microbial metabolism in diverse environments
sar01130  Biosynthesis of antibiotics
sar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR1326
Enzymes [BR:sar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SAR1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CAG40325
GeneDB: SAR1326
Position
complement(1376726..1377751)
Genome map
AA seq 341 aa AA seqDB search
MISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDCPNATIRFLVG
GTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEGKVSASDVETY
METFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPLFMDGARLGYG
LMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRIKHHGALLAKG
RLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFINKGYRLYFDSPTNQQFFILSNEKIA
ELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcattcgaaaatgattatttagaaggtgctcatgaaaaagtattaaaacgatta
gtagatacaaatcttgtacaagcttcgggatatggctttgatcaattcacagctcaggca
attgaaaagattaaagatacaattgactgtccaaatgctacaattcgttttttagtaggt
ggaacacaaaccaatcaggttgttattaattcaatgttagaaagttacgaaggggtcatt
tcagcagacactggtcatgttgctgtgcatgagggcggtgcaattgaatatagtggacat
aaagtaattactataccctctaaggaaggaaaagttagtgcttcagatgttgaaacttac
atggagacatttaaaagtgattttaaaaaggaccatatggtattcccaggaatggtatat
atttctcatcctactgaatatggcacattatactctaaatcagaattggaagagttatgc
aaagtatgtaagcaatatcagcttccattatttatggatggtgcacgattagggtatgga
ttgatgagtgatcaatcagatatgactattaaagacatcgctaaatattgtgatgtattt
tatataggtggtacgaagataggtgcattatgcggagaagcaattgtttttacgaagaat
aatgaaccgaaacaatttaccactcgaatcaaacatcacggtgcacttttagcaaaagga
cggttaacaggcatacaatttttagaattatttacggataatttatattttaatataagc
agacatgctatcgaaatggcaaataagatgaaagacgggtttataaataaaggctatcgt
ctttactttgattctccaaccaatcaacaattttttattttaagtaacgagaaaatagca
gagttagaacaaaaagttaaatttgctgtttgggaaaaatacgatgatcaacatcgtgtt
gttagattcgcaaccagttgggcgacaaccgaagaaaatttaaataaactattagaatta
atctaa

DBGET integrated database retrieval system