KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1424Help
Entry
SAR1424           CDS       T00182                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00020  Citrate cycle (TCA cycle)
sar00310  Lysine degradation
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01120  Microbial metabolism in diverse environments
sar01130  Biosynthesis of antibiotics
sar01200  Carbon metabolism
Module
sar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR1424 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    SAR1424 (odhB)
Enzymes [BR:sar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAR1424 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 IF3_N Herpes_LMP1
Motif
Other DBs
NCBI-ProteinID: CAG40421
GeneDB: SAR1424
UniProt: Q6GGZ6
Position
complement(1481753..1483024)
Genome map
AA seq 423 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNLGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
SEGDTVEVGQAIAVIGEGSGNASKENSNDNTPQQNDETTNNKKEETTNKSADKAEVNQTN
DDNQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKE
EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQF
MKDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF
VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA
AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL
LES
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttgaaaaacctaggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagttaatgtcgaagttgtatctgaagaagcaggtgtattatctgaacaacttgca
agtgaaggcgacactgtagaagttggacaagcaattgctgtcatcggcgaaggtagtggc
aatgcttctaaagaaaatagtaacgacaatactccacaacaaaatgatgaaacaacaaat
aataaaaaagaagaaacaacaaataaatcggcagataaagctgaagtcaatcaaacaaat
gatgacaatcagcagcgtgttaatgctacaccttctgcgcgtcgatatgctcgtgaaaat
ggtgtgaatcttgctgaagtaagtccgaaaacaaatgatgttgttcgtaaagaagatatt
gataagaaacaacaggcacctgcatcaacacaaacaacacaacaagcacctgcaaaagaa
gagaaaaaatacaatcaatatcctacaaaaccagtgattcgtgaaaaaatgtcacgcaga
aagaaaacagctgctaaaaaattattagaggtatctaataatacagctatgctaacaaca
tttaacgaagttgacatgacaaatgttatggaattgcgtaaacgtaagaaagaacaattt
atgaaagatcatgatggtactaaattaggatttatgtcattctttactaaagcttctgta
gcagctttgaaaaagtatccagaagttaatgcagaaatcgacggcgacgacatgattacg
aaacaatattatgatattggtgtagctgtttcgacagatgatggactattagtaccattc
gtaagagattgtgataaaaagaattttgcagaaatcgaagcagaaattgctaatttagct
gttaaagcacgagagaaaaaacttggcttagatgatatggttaatggttcatttacgatt
acaaatggcggtatttttggatcaatgatgagtacgccaattatcaatggtaatcaagct
gcaatcttaggcatgcattcaattattacaagaccaattgcgattgatcaagatacaatc
gaaaatcgtccaatgatgtatattgcattaagctatgatcatagaattattgacggtaaa
gaagcagttggattcttaaaaacaattaaagaattaattgaaaacccagaagacttatta
ttagaatcttaa

DBGET integrated database retrieval system