KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1582Help
Entry
SAR1582           CDS       T00182                                 

Gene name
zwf
Definition
(GenBank) putative glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00030  Pentose phosphate pathway
sar00480  Glutathione metabolism
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01120  Microbial metabolism in diverse environments
sar01130  Biosynthesis of antibiotics
sar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAR1582 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAR1582 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sar04147]
    SAR1582 (zwf)
Enzymes [BR:sar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SAR1582 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SAR1582 (zwf)
Exosome [BR:sar04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SAR1582 (zwf)
  Exosomal proteins of colorectal cancer cells
   SAR1582 (zwf)
  Exosomal proteins of bladder cancer cells
   SAR1582 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Caprin-1_dimer
Motif
Other DBs
NCBI-ProteinID: CAG40577
GeneDB: SAR1582
Position
1652481..1653965
Genome map
AA seq 494 aa AA seqDB search
MSTKNKHIPCLITIFGATGDLSHRKLFPSIFHLYQQDNLDEHIAIIGIGRRDITNDDFRN
QVKSSIQKHVKDTNKIDAFMEHVFYHRHDVSNEESYQELLDFSNELDSQFELKGNRLFYL
AMAPQFFGVISDYLKSSGLTDTKGFKRLVIEKPFGSDLKSAEALNNQIRKSFKEEEIYRI
DHYLGKDMVQNIEVLRFANAMFEPLWNNKYISNIQVTSSEILGVEDRGGYYESSGALKDM
VQNHMLQMVALLAMEAPISLNSEDIRAEKVKVLKSLRHFQSEDVKKNFVRGQYGEGYIDG
KQVKAYRDEDRVADDSNTPTFVSGKLTIDNFRWAGVPFYIRTGKRMKSKTIQVVVEFKEV
PMNLYYETDKLLDSNLLVINIQPNEGVSLHLNAKKNTQGIETEPVQLSYSMSAQDKMNTV
DAYENLLFDCLKGDATNFTHWEELKSTWKFVDAIQDEWNMVDPEFPNYESGTNGPLESDL
LLARDGNHWWDDIQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgagtactaaaaacaaacacatcccttgtttaatcacaatctttggtgcaactggtgac
ttaagccatcgtaagttgtttccatcaatattccatctctaccaacaagacaatttagat
gaacatattgccatcatcggtattggacgtcgtgacattactaatgatgatttccgtaat
caagtaaaatcatcaattcaaaagcacgtaaaagatacaaacaaaattgacgcgtttatg
gaacatgtcttctatcatagacatgatgttagtaatgaagaaagctatcaagaattatta
gattttagtaatgaattagacagccaatttgaattaaaaggtaatcgactattctattta
gcaatggcaccacaattctttggcgttatttctgattatctaaaatcttctggtcttact
gatacaaaaggatttaaacgccttgttatcgaaaaaccattcggtagtgatttaaaatca
gccgaagcattaaacaatcaaattcgtaaatcatttaaagaagaagaaatttatcgtatt
gaccactatttaggaaaagacatggttcaaaatatcgaggtattacgttttgcgaatgcg
atgtttgaaccattatggaataacaaatatatttcaaacatccaagttacatcttctgaa
atactaggtgttgaagatcgtggtggttattatgaatcaagtggtgcgctaaaagatatg
gtgcaaaaccacatgttacaaatggttgcattattagctatggaagcacctattagttta
aatagtgaagatatccgtgctgagaaagtaaaagtacttaaatcactgcgtcatttccaa
tctgaagatgttaaaaagaactttgttcgtggtcaatatggcgaaggctatatcgatggt
aaacaagttaaagcataccgtgatgaagatcgcgttgcagatgactctaacacacctaca
tttgtttcaggtaaattaacaattgataactttagatgggctggcgtaccattctatatc
cgtactggtaaacgtatgaaatctaaaacaattcaagttgtcgttgaatttaaagaagta
ccaatgaacttatactatgaaactgataaactgttagattcaaacctattagtaatcaat
attcaaccaaatgaaggtgtatctttacatctaaatgctaagaaaaatacacaaggtatc
gaaactgaacctgttcaattgtcttattcaatgagcgctcaagataaaatgaatactgta
gatgcatatgaaaatctattattcgattgtcttaaaggtgatgccactaactttacgcac
tgggaagaattaaaatcaacatggaaatttgttgatgcaattcaagatgaatggaatatg
gttgatccagaattccctaactatgaatcaggtactaatggtccattagaaagtgattta
ttacttgctcgtgatggtaaccattggtgggacgatattcaataa

DBGET integrated database retrieval system