KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR1851Help
Entry
SAR1851           CDS       T00182                                 

Gene name
ribA
Definition
(GenBank) riboflavin biosynthesis protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00740  Riboflavin metabolism
sar00790  Folate biosynthesis
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
Module
sar_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAR1851 (ribA)
   00790 Folate biosynthesis
    SAR1851 (ribA)
Enzymes [BR:sar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SAR1851 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SAR1851 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: CAG40842
GeneDB: SAR1851
UniProt: Q6GFT5
Position
complement(1940686..1941867)
Genome map
AA seq 393 aa AA seqDB search
MQFDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPV
SKDIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDF
NRPGHLFPLVAQDKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGTMAKGQDLQKF
KEKHKLKMITIDDLIEYRKKLEPEIEFKAKVKMPTDFGTFDMYGFKATYTDEEIVVLTKG
AIRQHENVRLHSACLTGDIFHSQRCDCGAQLESSMKYINEHGGMIIYLPQEGRGIGLLNK
LRAYELIEQGYDTVTANLALGFDEDLRDYHIAAQILKYFNIEHINLLSNNPSKFEGLKQY
GIDIAERIEVIVPETVHNHDYMETKKIKMGHLI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgataatattgacagtgctttaatggctttaaaaaatggagaaacaattatt
gtagtagatgatgagaatcgtgaaaatgaaggtgatttagtagcggtcactgaatggatg
aacgataataccattaattttatggcgaaagaagcaaggggattaatatgcgcaccagtg
tctaaagatattgcacaacgtttggatttggtacaaatggttgatgataactccgacatc
tttggtacgcaatttacagtgagtattgatcatgtagatacaacaacaggaataagcgct
tatgaacgtacattgactgccaaaaagctcattgatccaagtagtgaagctaaagatttt
aatcgtcctggtcatttatttccattagtagcacaagataaaggggtattagctcgtaat
ggtcatactgaagcggctgttgatttagctaaacttactggtgccaagcccgctggtgtc
atttgtgagattatgaatgatgacggcacgatggcgaaaggacaagatttacaaaagttt
aaagaaaaacataaattaaagatgattacgattgatgatttaattgaatatcgtaaaaaa
ttagaaccagaaattgaatttaaggcaaaagtgaaaatgcctacagatttcggaacattt
gatatgtatggttttaaagcgacttacacagatgaagagatagttgtactgacaaaaggt
gcaattcgacaacatgaaaatgtacgcttacattctgcgtgccttacaggcgatattttc
catagtcaacgttgtgattgtggtgctcaacttgaatcgtctatgaagtatatcaatgaa
catggcggcatgattatttatctacctcaagaaggtcgtggcataggattgttaaacaaa
ttacgcgcatatgaattaattgagcaaggatatgatacagtaactgcaaatttagcatta
ggttttgatgaagatttgcgagattatcatattgctgcacagattttaaaatattttaac
atcgaacatatcaatttattaagtaataatccaagtaaattcgaaggattaaaacaatat
ggcattgatattgcagaaagaattgaagttatcgtaccagaaacggtacataatcatgat
tatatggaaacgaaaaaaataaaaatgggtcatttaatatag

DBGET integrated database retrieval system