KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2454Help
Entry
SAR2454           CDS       T00182                                 

Gene name
mqo1
Definition
(GenBank) putative malate:quinone oxidoreductase 1
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00020  Citrate cycle (TCA cycle)
sar00620  Pyruvate metabolism
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01120  Microbial metabolism in diverse environments
sar01130  Biosynthesis of antibiotics
sar01200  Carbon metabolism
Module
sar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR2454 (mqo1)
   00620 Pyruvate metabolism
    SAR2454 (mqo1)
Enzymes [BR:sar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SAR2454 (mqo1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CAG41436
GeneDB: SAR2454
UniProt: Q6GE66
Position
complement(2522500..2524035)
Genome map
AA seq 511 aa AA seqDB search
MSYFSNVPLFILKRGTVFVMTTQHSKTDVILIGGGIMSATLGTLLKELSPEKNIKVFEKL
AQPGEESSNVWNNAGTGHSALCELNYTKEGKDGTVDCSKAIKINEQYQISKQFWAYLVKT
GQLDNPDRFIQAVPHMSFVIGEDNVAFIKSRVATLKKNVLFEKMKLSQDEEEMKSWVPLM
IEGRKSDEPIALTYDETGTDVNFGALTAKLFDNLEQRGVEIQYKQNVLDIKKQKSGAWLV
KVKDLETNETTTYESDFVFIGAGGASLPLLQKTGIKQSKHIGGFPVSGLFLRCTNQEVID
RHHAKVYGKAAVGAPPMSVPHLDTRFVDGKRSLLFGPFAGFSPKFLKTGSHMDLIKSVKP
NNIVTMLSAGIKEMSLTKYLVSQLMLSNDERMDDLRVFFPNAKNEDWEVITAGQRVQVIK
DTEDSKGNLQFGTEVITSDDGTLAALLGASPGASTAVDIMFDVLQRCYRDEFKGWEPKIK
EMVPSFGYRLTDHEDLYHKINEEVTKYLQVK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatttctcgaacgttccattattcattttaaaaagggggactgtatttgttatg
acaacacaacatagcaaaacagatgtcatcttaattggtggcggtattatgagtgcaaca
ttaggaacattacttaaagaattatcacctgagaaaaatattaaagtgtttgaaaaatta
gcacaacctggcgaagagagttcaaatgtatggaataatgccggtacagggcattcagca
ctttgcgagttgaactatacaaaagaaggtaaggatggcacagttgattgtagtaaagca
attaagataaatgagcagtaccaaatttcaaagcagttttgggcatatttagttaaaaca
ggacaattagataacccagatcgctttattcaagcggtgccacacatgagttttgtcatt
ggcgaagataacgtagcttttataaaaagtcgtgttgcaacgttaaagaaaaatgtttta
ttcgaaaaaatgaaattatcgcaagatgaagaagaaatgaaatcttgggtaccgttaatg
attgaagggcgtaagtctgatgaaccaattgctttaacttatgatgaaactggtacagat
gttaactttggtgcgttaactgcaaagttatttgataatttagaacaacgtggtgtggaa
attcaatataagcaaaatgtattagacatcaagaaacagaaatctggagcatggctagtt
aaagttaaagatttagaaactaacgaaacgacaacatatgaatctgattttgtatttatt
ggtgctggcggtgcgagtttaccattactccaaaagactggaattaaacaatcaaaacat
attggtggtttcccggtaagtggattattcctgcgctgtacaaatcaagaagtgattgat
cgtcatcatgctaaagtgtacggaaaagcagcagtgggtgcgccaccaatgtcagtgcca
cacttagatacacgttttgtagacggcaagcgttcattgttatttggtccatttgcaggt
ttctcacctaaatttttaaaaacaggttcacatatggatttaattaaatcggttaaacca
aataatatcgtgacgatgttatctgcaggtatcaaagaaatgagtcttacgaagtattta
gtgtcacaattgatgttatctaatgatgagcgtatggatgatttaagagtctttttccca
aatgctaaaaatgaagattgggaagtgattacagcagggcaacgtgtccaagtaatcaag
gatacggaggattctaaaggtaacttacaatttggtaccgaagtcattacgtcagatgat
ggcacattagctgcattacttggtgcatcacctggtgcgtcaacagctgtagatattatg
tttgatgttttacagcgatgctatcgtgatgaattcaaaggatgggaaccaaagattaaa
gaaatggtgccgtcatttggttatcgcttaacagatcatgaggatttatatcacaaaatt
aatgaagaagtaactaagtatttacaagttaaataa

DBGET integrated database retrieval system