KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2625Help
Entry
SAR2625           CDS       T00182                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00900  Terpenoid backbone biosynthesis
sar01110  Biosynthesis of secondary metabolites
sar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sar00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAR2625 (mvaA)
Enzymes [BR:sar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SAR2625 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red UPF0180 Co_AT_N YAcAr
Motif
Other DBs
NCBI-ProteinID: CAG41604
GeneDB: SAR2625
Position
complement(2709121..2710401)
Genome map
AA seq 426 aa AA seqDB search
MQSLDKNFRHLSRQQKLQQLVDKQWLSEEQFNILLNHPLIDEEVANSLIENVIAQGALPV
GLLPNIIVDDKAYVVPMMVEEPSVVAAASYGAKLVNQTGGFKTVSSERIMIGQIVFDGVD
DTEKLSADIKALEKQIHQIADEAYPSIKARGGGYQRIAIDTFPEQQLLSLKVFVDTKDAM
GANMLNTILEAITAFLKNEFPQSDILMSILSNHATASVVKVQGEIDVKDLARGERTGEEV
AKRMERASVLAQVDIHRAATHNKGVMNGIHAVVLATGNDTRGAEASAHAYASKDGQYRGI
ATWRYDQERQRLIGTIEVPMTLAIVGGGTKVLPIAKASLELLNVESAQELGHVVAAVGLA
QNFAACRALVSEGIQQGHMSLQYKSLAIVVGAKGDEIAQVAEALKQEPRANTQVAERILQ
DLRSQQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtttagataagaatttccgacatttatctcgtcaacaaaagttacaacaattg
gtagataagcaatggttatcagaagagcaattcaacattttattgaatcatccattaatt
gatgaggaagtagcaaatagtttaattgaaaatgtcatcgcgcaaggtgcattacccgtt
ggattattaccgaatatcattgtggacgataaagcatatgttgtacctatgatggtggaa
gagccttcagttgtcgctgcagctagttatggtgcaaagctagtgaatcagactggtgga
tttaaaacggtatcttctgaacgtattatgataggtcaaatcgtctttgatggcgttgac
gatactgaaaaattatcagcagacattaaagctttagagaagcaaattcatcaaattgcg
gatgaggcatatccttctattaaagcgcgtggtggtggttaccaacgtatagctattgat
acatttcctgagcaacagttactatctttaaaagtatttgttgatacgaaagatgctatg
ggcgctaatatgcttaatacgattttagaggctataactgcatttttaaaaaatgaattt
ccgcaaagcgacattttaatgagtattttatccaatcatgcaacagcgtccgttgttaaa
gttcaaggcgaaattgatgttaaagatttagcaaggggcgagagaactggagaagaggtt
gccaaacgaatggaacgtgcttctgtattggcacaagttgatattcatcgtgctgcaaca
cataataaaggtgttatgaatggcatacatgccgttgttttagcaacaggaaatgatacg
cgtggtgcagaagcaagtgcgcatgcatacgcgagtaaagatggtcaatatcgtggtatt
gcaacatggagatacgatcaagaacgtcaacgtttaattggtaccatagaggtgcctatg
acattggcaatcgttggcggtggtacaaaagtattaccaatagctaaagcatcattagag
ctactaaatgtagagtcagcgcaagaattaggtcatgtagttgctgccgttggtttagca
caaaactttgcagcatgtcgcgcgctcgtttctgaaggtatccagcaaggccatatgagc
ttgcaatataaatctttagctattgttgtaggtgcaaaaggtgatgaaattgcgcaagta
gctgaagcattgaagcaagaacctcgtgcgaatacacaagttgctgaacgcattttacaa
gatttaagaagccaacaataa

DBGET integrated database retrieval system