KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0601
Entry
SAS0601           CDS       T00183                                 

Definition
(GenBank) putative membrane protein
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Motif
Pfam: Peptidase_M50B Otopetrin Peptidase_M50
Other DBs
NCBI-ProteinID: CAG42376
GeneDB: SAS0601
Position
complement(677937..678689)
AA seq 250 aa
MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLF
NKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLIGLAS
SHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMS
YQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVN
ILLKYTHLIN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgaattatttatcaaacttttttaatacgacaattcaacttaatatatacattatcgtt
attgttgcagcttgttatattgctattcatcaatatagacataagcctgttttgaactat
ttagatgtcattttaaactatatccctgttttaacacatgaatttggtcatgtactgttt
aataaactcgctggtggccgtgcaaaagatttagtcattgtaacaagtccacgagagcga
caacagacattacaacaaggattcgcaattacacaatctagacatctagcaggccaatgg
cttacaacgattggtggttatttaatgccacctattatgttattgataggtttagcgtcg
agccattatcagatacctagtttctttatatttacctatttattgatatttatttatttt
ttaattttaacatctagaaaaggctcacccattgttgttataactttaatttctatcatg
ttgtattttatattaaaagatgaaaatatagtagaaattcaactacttgtcacaatgagt
tatcaatatattttaggtgtattattaggcgaagttctacaatctagttggacgattgct
aaattgactttccagcgtccgagtccacagtgggatggtagtgcacttaaagaactcagt
catgtacctatcttcatttatagtacaatctggattatcttcaatctttatgcagtgaat
attttactcaaatatactcacttgataaattaa

DBGET integrated database retrieval system