KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0727
Entry
SAS0727           CDS       T00183                                 
Name
(GenBank) putative acetyltransferase
  KO
K24872  heptaprenylglycerol acetyltransferase [EC:2.3.1.-]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00564  Glycerophospholipid metabolism
sas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAS0727
Enzymes [BR:sas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     SAS0727
SSDB
Motif
Pfam: Hexapep_2 Hexapep
Other DBs
NCBI-ProteinID: CAG42503
UniProt: Q6GB68
Position
814327..814812
AA seq 161 aa
MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
NT seq 486 nt   +upstreamnt  +downstreamnt
ttgagaaaatttttatcaaaaacacatcatcatacaaaccctttatggcgtgtataccgt
cttgttaaattttcgaaagtttttaagaatgtaattatcattgaattttcgaaatttatt
ccaagtatggtactgaaaagacatatatataaacaacttttaaatattaatatcggtaat
caatcgtcgatagcttataaagtaatgttagatattttttacccagaactgattacgatt
ggtagtaacagtgttattggttacaatgtaacaattttgacgcatgaagcattagttgat
gaatttcgttatggaccagtgacgataggatctaacactttgattggtgcaaatgctacc
attttacccggtataacgattggtgacaatgtaaaagttgcagctggtacggttgtttca
aaagatataccggataatggatttgcatatggcaaccctatgtatataaaaatgattagg
aggtga

DBGET integrated database retrieval system