KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0936
Entry
SAS0936           CDS       T00183                                 

Definition
(GenBank) hypothetical phage protein
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
SSDB
Motif
Pfam: Phage_connect_1
Other DBs
NCBI-ProteinID: CAG42712
GeneDB: SAS0936
Position
1006878..1007156
AA seq 92 aa
MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIAR
DYESRGYSNDQSRSKVFNEKGLQKMILKLKKW
NT seq 279 nt   +upstreamnt  +downstreamnt
atgagtttagaagaaattaaattgtggttgagaattgactataatttcgaaaatgattta
attgaaggtctcattcaatcggctaagtctgaattactattaagtggggttccagattat
gacaaagatgacttggaatacccgcttttttgtacagcgattaaatatatcattgcaaga
gattatgaaagtcgtggatactcaaatgaccaatctagaagcaaggtgtttaatgaaaaa
ggattgcaaaaaatgattttgaaattaaaaaagtggtag

DBGET integrated database retrieval system