KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0987
Entry
SAS0987           CDS       T00183                                 

Name
(GenBank) MarR family regulatory protein
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 TrmB
Other DBs
NCBI-ProteinID: CAG42762
GeneDB: SAS0987
Position
1056155..1056574
AA seq 139 aa
MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
ELDNLNQLLDKLNQRRISL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtataaacaacttgaaaaacttattacactgactaacaatgacttaaacttagtgaat
agaagatttggacaacgcacggatatcacatctgaacagctagaacttctccgtatttta
tttaattacgatcgcttatcacagtatgatttgacgatgaagattagcagggaacaatct
atagtttcaaggtggattaagaaattagttttgaaagggtacatcacaagtcaacaatct
agcgaagatttaagatgtaaagaattaattttgactgatcaagcacgtacattaatttca
caaataaataatgcacgttgcgaattgattgaagcaagatgtcaatgtttatcggaagtc
gaattagacaatttaaatcaattacttgataagttaaatcaacgacgcatatcgttgtaa

DBGET integrated database retrieval system