KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS1032
Entry
SAS1032           CDS       T00183                                 

Name
(GenBank) conserved hypothetical protein
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
SSDB
Motif
Pfam: UPF0223 Tk-SP_N-pro
Other DBs
NCBI-ProteinID: CAG42806
GeneDB: SAS1032
UniProt: Q6GAB7
Position
1106109..1106384
AA seq 91 aa
MEYEYPIDLDWSNEEMISVINFFNHVEKYYESGVTAGDFMGAYKRFKEIVPAKAEEKQIF
NTFEKSSGYNSYKAVQDVKTHSEEQRVTAKK
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaatatgagtatccaattgatttagactggagtaatgaagagatgatttcagtgata
aatttctttaatcatgtagagaagtattatgaatccggcgtgacggcaggcgactttatg
ggtgcatataaaagatttaaagaaattgtgcctgctaaagcagaggaaaaacaaattttt
aatactttcgaaaaaagtagtggctataatagttacaaagcagttcaagatgtaaaaact
cactctgaagaacaaagagtaacagctaaaaaataa

DBGET integrated database retrieval system